DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and HADHA

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_000173.2 Gene:HADHA / 3030 HGNCID:4801 Length:763 Species:Homo sapiens


Alignment Length:354 Identity:77/354 - (21%)
Similarity:132/354 - (37%) Gaps:97/354 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSSVLATESSNKG------MIILNRPKA-LNAINLEM---VRKIYKHLKKCEKSKSLVIIKGTGD 98
            ||::|.....|.|      ::.:|.|.: :|.::.|:   ..::...:...::.:|.|:| .:..
Human    32 SSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLI-SSKP 95

  Fly    99 KAFCAGGDVRALVEAGPTDESKSFFRE--------EYSTNALIGNYKIPYIAIIDGITMGGGVGL 155
            ..|.||.|:..|.......|.....:|        |.||.        |.:|.|:|..:|||:.:
Human    96 GCFIAGADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTK--------PIVAAINGSCLGGGLEV 152

  Fly   156 SVHGKYRVAS-DR-TLFAMPETAIGLFPDVGGSYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGI 217
            ::..:||:|: || |:...||..:|..|..||:..||::.| ...|.:.|||..:|.......|:
Human   153 AISCQYRIATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGL 217

  Fly   218 ATHYCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSADSVEGILEN 282
                                  .|.:.|.|.....|||                     |..:|.
Human   218 ----------------------VDQLVEPLGPGLKPPE---------------------ERTIEY 239

  Fly   283 LQNDGSEWAKKTLETLSKMSPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVRHLERSDFK---EG 344
            |:.....:||...:  .|:||...|....:|             ..|.:.:..:.:..:|   |.
Human   240 LEEVAITFAKGLAD--KKISPKRDKGLVEKL-------------TAYAMTIPFVRQQVYKKVEEK 289

  Fly   345 VRALLIDKDQKPQW-QPTKLADVTEEHVQ 372
            ||     |..|..: .|.|:.||.:..::
Human   290 VR-----KQTKGLYPAPLKIIDVVKTGIE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 77/354 (22%)
ECH_2 56..374 CDD:292731 73/342 (21%)
HADHANP_000173.2 fa_ox_alpha_mit 27..762 CDD:131494 77/354 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.