DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Echdc2

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001100145.1 Gene:Echdc2 / 298381 RGDID:1308525 Length:296 Species:Rattus norvegicus


Alignment Length:333 Identity:73/333 - (21%)
Similarity:132/333 - (39%) Gaps:85/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SVRQSSSSVLATESSNKGM--IILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVI------IKG 95
            |.|.....|.|....|:|:  |::|||.|.||:....|.::.:.|.:..:.:.:.:      :||
  Rat    28 STRTPEIQVQALTGPNQGITEILMNRPHARNALGNVFVSELLEALAQLREDQQVRVLLFRSAVKG 92

  Fly    96 TGDKAFCAGGDVR-----ALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGL 155
                .||||.|::     :..|.|      :|.:......:.|..:..|.||.:||..:|||:.|
  Rat    93 ----VFCAGADLKERERMSAAEVG------TFVQRLRGLMSEIAAFPAPTIAAMDGFALGGGLEL 147

  Fly   156 SVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGIAT 219
            ::....|:|:...:..:.||..||.|..||:..|||..| .|...|..||.||.|...:..|:..
  Rat   148 ALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGVQAHELGLVN 212

  Fly   220 HYCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSL-QPVLEQINKNFSADSVEGILENL 283
            |....::..|                  ..||    :..:| |.:|.|                 
  Rat   213 HAVAQNEEGD------------------AAYH----RALALAQEILPQ----------------- 238

  Fly   284 QNDGSEWAKKTLETLSKMSPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRAL 348
                              :|.::::....::.|.::.:|..:.:|:....:::...|..||:.|.
  Rat   239 ------------------APIAVRLGKVAIDRGMEVDIASGMAIEHMCYAQNIPTQDRLEGMAAF 285

  Fly   349 LIDKDQKP 356
               ::::|
  Rat   286 ---REKRP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 71/328 (22%)
ECH_2 56..374 CDD:292731 68/316 (22%)
Echdc2NP_001100145.1 crotonase-like 42..296 CDD:304874 69/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.