DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Eci1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_059002.2 Gene:Eci1 / 29740 RGDID:61892 Length:289 Species:Rattus norvegicus


Alignment Length:264 Identity:59/264 - (22%)
Similarity:111/264 - (42%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RQSSSSVLATESSNKGMIIL---NRPKALNAINLEMVRKIYKHLKKCEKSKSL--VIIKGTGDKA 100
            |.|:..||..:....|:.::   |.|  :|:::||.:.:....|:|.|..||:  ||:.......
  Rat    28 RFSNKRVLVEKEGEAGIAVMKFKNPP--VNSLSLEFLTEFVISLEKLENDKSIRGVILTSERPGI 90

  Fly   101 FCAGGDVRALVEAGPTDESKSFFR--EEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRV 163
            |.||.|:..:....|...:: :::  :|......:.|  :..|:.|:|.:..||..:::...||:
  Rat    91 FSAGLDLMEMYGRNPAHYAE-YWKAVQELWLRLYLSN--LTLISAINGASPAGGCLMALTCDYRI 152

  Fly   164 ASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCE----- 223
            .:|.     |:..|||            .:..||:   :..:.|:  |.|.:.|.....|     
  Rat   153 MADN-----PKYTIGL------------NESLLGI---VAPFWLK--DNYVNTIGHRAAERALQL 195

  Fly   224 SSKIPDLETALLNCPDADDVPE--LLQKYHSPPEKPFSLQPVLEQINKNF----SADSV----EG 278
            .:..|..|...:...| :.|||  :..|..|...|.|::.....|:.|:.    :||::    |.
  Rat   196 GTLFPPAEALKVGLVD-EVVPEDQVHSKARSVMAKWFTIPDHSRQLTKSMMRKATADNLIKQREA 259

  Fly   279 ILEN 282
            .::|
  Rat   260 DIQN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 57/261 (22%)
ECH_2 56..374 CDD:292731 55/249 (22%)
Eci1NP_059002.2 ECH_1 39..285 CDD:278790 55/253 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P42126 93..97 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.