DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Cdyl2

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:318 Identity:60/318 - (18%)
Similarity:117/318 - (36%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGPIQRLV-----YTFGHRTCSQLPMIGGATISQTKPTTMALSVRQSSSS------VLATESSN 54
            :..|::|.:     |.|..|                    :..||||:.|:      |:..|...
  Rat   261 LHSPVKRKLETEKDYVFDKR--------------------LRYSVRQNESNCRFRDIVVRKEEGF 305

  Fly    55 KGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDES 119
            ..:::.::....||:..|:::::.:.|.......|.:::.......||:|.|...|:....:|..
  Rat   306 THILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRR 370

  Fly   120 KSFFREEYSTNALIG---NYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFP 181
            |...|...:....:.   .:|.|.:..|:|..:|.|..:........||::..|..|...|.|.|
  Rat   371 KESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTP 435

  Fly   182 DVGGSYFLPRLQGKLGLYLG----LTGYRLRGADVYYSGIA------THYCESSKIPDLETALLN 236
            ....||..|::   ||:.|.    ..|.:|...:....|:.      |.:.:...:...|.|..:
  Rat   436 AGCSSYTFPQI---LGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCS 497

  Fly   237 CPDADDVPELLQKYHSPPEKPFSLQPVLEQINKN---------FSADSVEGILENLQN 285
            ....:|...|::.:         |:.|||.:|:.         .|:..::.:...||:
  Rat   498 AVVLEDSKCLVRSF---------LKSVLEDVNEKECLMLKQLWSSSKGLDSLFSYLQD 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 51/270 (19%)
ECH_2 56..374 CDD:292731 48/252 (19%)
Cdyl2XP_017456726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.