DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and EHHADH

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001957.2 Gene:EHHADH / 1962 HGNCID:3247 Length:723 Species:Homo sapiens


Alignment Length:229 Identity:57/229 - (24%)
Similarity:89/229 - (38%) Gaps:32/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TESSNKGMIILNRPKALNAINLEMVRKIYKHLKKC---EKSKSLVIIKGTGDKAFCAGGDVRALV 111
            |...|...:|..|...:|||:..::|.|.:.|:|.   ...|::||....|  .|.||.|:|...
Human     5 TRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEG--KFSAGADIRGFS 67

  Fly   112 EAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETA 176
            .......:.....:|...|      :.|.:|.|.|:..|||:.|::...||:|.......:||..
Human    68 APRTFGLTLGHVVDEIQRN------EKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVT 126

  Fly   177 IGLFPDVGGSYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDA 240
            :||.|...|:..||||.| ...|.|..:|.|:...:....||.             ..::|....
Human   127 LGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGIL-------------DKVVNSDPV 178

  Fly   241 DDVPELLQKYHSPP-------EKPFSLQPVLEQI 267
            ::.....|:....|       .||....|.::.|
Human   179 EEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 57/229 (25%)
ECH_2 56..374 CDD:292731 55/223 (25%)
EHHADHNP_001957.2 Enoyl-CoA hydratase / isomerase 1..282 57/229 (25%)
fadJ 20..705 CDD:333311 53/214 (25%)
3-hydroxyacyl-CoA dehydrogenase 283..572
Microbody targeting signal 721..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.