DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and C32E8.9

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_491222.2 Gene:C32E8.9 / 171951 WormBaseID:WBGene00016325 Length:268 Species:Caenorhabditis elegans


Alignment Length:172 Identity:39/172 - (22%)
Similarity:84/172 - (48%) Gaps:11/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KPTTMALSVRQSSSSVLATESSNKGM-----IILNRPKALNAINLEMVRKIYKHLKK-CEKSKSL 90
            :|:...|.|.:|..........|:.:     :||:||:..|.::.||:::..:|.:. .:...::
 Worm     7 RPSAALLEVFKSWQGGAIRVQRNEKLKTRLDVILDRPEKNNCLSGEMMKQFGEHTELFSDDQNAI 71

  Fly    91 VIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAI--IDGITMGGGV 153
            :::.|.| |:||:|.|:..:.:.  :|:.......||.::.|...:..|.|:|  |.|..:||..
 Worm    72 IVVSGVG-KSFCSGADLGLIKDI--SDQKLGVQMFEYMSSILSLLHSSPAISIAKIHGHALGGAT 133

  Fly   154 GLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGK 195
            .:......|:|...:..|..::.:|:.|..||:.::..:.|:
 Worm   134 EICSSTDIRIAHSGSKIAFFQSKMGIVPSWGGAEYMEGIMGR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 35/160 (22%)
ECH_2 56..374 CDD:292731 34/148 (23%)
C32E8.9NP_491222.2 crotonase-like 24..207 CDD:119339 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.