Sequence 1: | NP_732020.2 | Gene: | CG5044 / 41869 | FlyBaseID: | FBgn0038326 | Length: | 386 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598290.1 | Gene: | Ehhadh / 171142 | RGDID: | 621441 | Length: | 722 | Species: | Rattus norvegicus |
Alignment Length: | 207 | Identity: | 54/207 - (26%) |
---|---|---|---|
Similarity: | 97/207 - (46%) | Gaps: | 31/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 MIILNRPKALNAINLEMVRKIYKHLKKCEKS---KSLVIIKGTGDKAFCAGGDVRALVEAGPTDE 118
Fly 119 SKSFFREEYSTNAL---IGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLF 180
Fly 181 PDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPE 245
Fly 246 LLQKYHSPPEKP 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5044 | NP_732020.2 | PRK05617 | 44..376 | CDD:235533 | 54/207 (26%) |
ECH_2 | 56..374 | CDD:292731 | 54/207 (26%) | ||
Ehhadh | NP_598290.1 | Enoyl-CoA hydratase / isomerase | 1..281 | 54/207 (26%) | |
crotonase-like | 12..187 | CDD:119339 | 51/198 (26%) | ||
fadJ | 20..706 | CDD:236864 | 50/199 (25%) | ||
3-hydroxyacyl-CoA dehydrogenase | 282..571 | ||||
3HCDH_N | 298..475 | CDD:280833 | |||
3HCDH | 477..581 | CDD:279114 | |||
3HCDH | 618..704 | CDD:279114 | |||
Microbody targeting signal | 720..722 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1024 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |