DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Ehhadh

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_598290.1 Gene:Ehhadh / 171142 RGDID:621441 Length:722 Species:Rattus norvegicus


Alignment Length:207 Identity:54/207 - (26%)
Similarity:97/207 - (46%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MIILNRPKALNAINLEMVRKIYKHLKKCEKS---KSLVIIKGTGDKAFCAGGDVRALVEAGPTDE 118
            ||.|..| .:||::..::|::...|:|....   |::||....|:  ||||.|:...        
  Rat    13 MIRLCNP-PVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGN--FCAGADIHGF-------- 66

  Fly   119 SKSFFREEYSTNAL---IGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLF 180
              |.|....:..:|   |..|:.|.:|.|.|:.:|||:.|::...||:|:.:....:||..:|:.
  Rat    67 --SAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGIL 129

  Fly   181 PDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDADDVPE 245
            |...|:..|||:   :|:.:.|        |:..||......|:.::..|:..:.:.| .::..:
  Rat   130 PGARGTQLLPRV---VGVPVAL--------DLITSGKYLSADEALRLGILDAVVKSDP-VEEAIK 182

  Fly   246 LLQKYHSPPEKP 257
            ..||....|.:|
  Rat   183 FAQKIIDKPIEP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 54/207 (26%)
ECH_2 56..374 CDD:292731 54/207 (26%)
EhhadhNP_598290.1 Enoyl-CoA hydratase / isomerase 1..281 54/207 (26%)
crotonase-like 12..187 CDD:119339 51/198 (26%)
fadJ 20..706 CDD:236864 50/199 (25%)
3-hydroxyacyl-CoA dehydrogenase 282..571
3HCDH_N 298..475 CDD:280833
3HCDH 477..581 CDD:279114
3HCDH 618..704 CDD:279114
Microbody targeting signal 720..722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.