DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Hadha

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_570839.2 Gene:Hadha / 170670 RGDID:620512 Length:763 Species:Rattus norvegicus


Alignment Length:303 Identity:70/303 - (23%)
Similarity:125/303 - (41%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSSSVLATESSNKG------MIILNRPKA-LNAIN-------LEMVRKIYKHLKKCEKSKSLVII 93
            :||::|:....|.|      :|.:|.|.: :|.:|       :|::.:|:.:    ::.:|.|:|
  Rat    31 TSSALLSRTHINYGVKGDVAVIRINSPNSKVNTLNKEVQSEFVEVMNEIWAN----DQIRSAVLI 91

  Fly    94 KGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVH 158
             .:....|.||.|:..|.......|:....:|.......:.....|.:|.|.|..:|||:.|::.
  Rat    92 -SSKPGCFVAGADINMLASCTTPQEAARISQEGQKMFEKLEKSPKPVVAAISGSCLGGGLELAIA 155

  Fly   159 GKYRVAS-DR-TLFAMPETAIGLFPDVGGSYFLPRLQGKLGLY-LGLTGYRLRGADVYYSGIATH 220
            .:||:|: || |:..:||..:|:.|..||:..||::.|....: :.|||..:|.......|:...
  Rat   156 CQYRIATKDRKTVLGVPEVLLGILPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQ 220

  Fly   221 YCESSKIPDLETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQINKNF---------SADSV 276
            .                     |..|.....||.|:...   .||::..||         ||...
  Rat   221 L---------------------VDPLGPGIKSPEERTIE---YLEEVAVNFAKGLADRKVSAKQS 261

  Fly   277 EGILENLQNDG------SEWAKKTLETLSK-----MSPTSMKV 308
            :|::|.|.:..      .:...||:|...|     :.|..:|:
  Rat   262 KGLMEKLTSYAMTIPFVRQQVYKTVEEKVKKQTKGLYPAPLKI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 70/302 (23%)
ECH_2 56..374 CDD:292731 66/290 (23%)
HadhaNP_570839.2 fa_ox_alpha_mit 29..762 CDD:131494 70/303 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.