DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and Echs1

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_511178.1 Gene:Echs1 / 140547 RGDID:69330 Length:290 Species:Rattus norvegicus


Alignment Length:257 Identity:72/257 - (28%)
Similarity:117/257 - (45%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSL--VIIKGTGDKAFCAGGDVRALVEA 113
            ::|:.|:|.|||||||||:...::.::.:.|:..|:..::  :::.| |:|||.||.|::.:   
  Rat    43 KNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTG-GEKAFAAGADIKEM--- 103

  Fly   114 GPTDESKSFFREEYSTNAL-----IGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMP 173
                 ....|::.||...|     |...|.|.||.::|..:|||..|::......|.::..|..|
  Rat   104 -----QNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQP 163

  Fly   174 ETAIGLFPDVGGSYFLPRLQGK-LGLYLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNC 237
            |..:|..|..||:..|.|..|| |.:.:.|||.|:...|...:|:.      |||..:||.    
  Rat   164 EILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLV------SKIFPVETL---- 218

  Fly   238 PDADDVPELLQKYHSPPEKPFSLQPVLEQINKN------FSADSVEGILENLQNDGSEWAKK 293
                 |.|.:|              ..|:|..|      .:.:||....|....:|::..||
  Rat   219 -----VEEAIQ--------------CAEKIANNSKIIVAMAKESVNAAFEMTLTEGNKLEKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 72/257 (28%)
ECH_2 56..374 CDD:292731 71/252 (28%)
Echs1NP_511178.1 crotonase-like 32..288 CDD:419961 72/257 (28%)
Substrate binding 98..101 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.