DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and CDYL2

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:318 Identity:59/318 - (18%)
Similarity:117/318 - (36%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGPIQRLV-----YTFGHRTCSQLPMIGGATISQTKPTTMALSVRQSSSS------VLATESSN 54
            :..|::|.:     |.|..|                    :..||||:.|:      |:..|...
Human   250 LHSPVKRKLEAEKDYVFDKR--------------------LRYSVRQNESNCRFRDIVVRKEEGF 294

  Fly    55 KGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDES 119
            ..:::.::....||:..|:::::.:.|.......|.:::.......||:|.|...|:....:|..
Human   295 THILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRR 359

  Fly   120 KSFFREEYSTNALIG---NYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFP 181
            |...|...:....:.   .:|.|.:..|:|..:|.|..:........||::..|..|...|.|.|
Human   360 KESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTP 424

  Fly   182 DVGGSYFLPRLQGKLGLYLG----LTGYRLRGADVYYSGIA------THYCESSKIPDLETALLN 236
            ....||..|::   ||:.|.    ..|.:|...:....|:.      |.:.:...:...|.|..:
Human   425 AGCSSYTFPQI---LGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCS 486

  Fly   237 CPDADDVPELLQKYHSPPEKPFSLQPVLEQINKN---------FSADSVEGILENLQN 285
            ....::...|::.:         |:.|||.:|:.         .|:..::.:...||:
Human   487 AVVLEESKCLVRSF---------LKSVLEDVNEKECLMLKQLWSSSKGLDSLFSYLQD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 50/270 (19%)
ECH_2 56..374 CDD:292731 47/252 (19%)
CDYL2XP_011521168.1 CHROMO 40..89 CDD:214605
crotonase-like 286..482 CDD:119339 38/198 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.