DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5044 and ehhadh

DIOPT Version :9

Sequence 1:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_996951.1 Gene:ehhadh / 100000859 ZFINID:ZDB-GENE-040426-2581 Length:718 Species:Danio rerio


Alignment Length:187 Identity:46/187 - (24%)
Similarity:77/187 - (41%) Gaps:42/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MIILNRPKALNAINLEMVRKIYKHLKKC--EKSKSLVIIKGTGDKAFCAGGDVRAL--------- 110
            :|.|..| .:||::..:...|.|.:::.  :...:.|:|.|...: ||.|.|:|..         
Zfish    13 LITLTNP-PVNALSSAVRHAISKTMERALSDPKVTAVVICGENGR-FCGGADIREFAGPLRGPPL 75

  Fly   111 ------VEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTL 169
                  :|||                      :.|.:|.|:|:.:|||..|::...||:|..:..
Zfish    76 VPLLDAIEAG----------------------EKPVVAAIEGVALGGGFELALVCHYRIAHYKAR 118

  Fly   170 FAMPETAIGLFPDVGGSYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGIATHYCESS 225
            ..:||..:|:.|..||:..||||.| ...|.|..||..:...:....|:.....|.:
Zfish   119 LGLPEVTLGILPAAGGTQRLPRLIGIPAALELITTGRHVSAQEALKLGMVDQVTEQN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 46/187 (25%)
ECH_2 56..374 CDD:292731 46/187 (25%)
ehhadhNP_996951.1 Enoyl-CoA hydratase / isomerase 2..280 46/187 (25%)
fadJ 11..702 CDD:236864 46/187 (25%)
crotonase-like 11..186 CDD:119339 46/187 (25%)
3-hydroxyacyl-CoA dehydrogenase 281..567
3HCDH_N 297..471 CDD:280833
3HCDH 473..577 CDD:279114
3HCDH 617..700 CDD:279114
Microbody targeting signal. /evidence=ECO:0000250 716..718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.