DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hibch and ehhadh

DIOPT Version :10

Sequence 1:NP_732020.2 Gene:Hibch / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_996951.1 Gene:ehhadh / 100000859 ZFINID:ZDB-GENE-040426-2581 Length:718 Species:Danio rerio


Alignment Length:187 Identity:46/187 - (24%)
Similarity:77/187 - (41%) Gaps:42/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MIILNRPKALNAINLEMVRKIYKHLKKC--EKSKSLVIIKGTGDKAFCAGGDVRAL--------- 110
            :|.|..| .:||::..:...|.|.:::.  :...:.|:|.|...: ||.|.|:|..         
Zfish    13 LITLTNP-PVNALSSAVRHAISKTMERALSDPKVTAVVICGENGR-FCGGADIREFAGPLRGPPL 75

  Fly   111 ------VEAGPTDESKSFFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTL 169
                  :|||                      :.|.:|.|:|:.:|||..|::...||:|..:..
Zfish    76 VPLLDAIEAG----------------------EKPVVAAIEGVALGGGFELALVCHYRIAHYKAR 118

  Fly   170 FAMPETAIGLFPDVGGSYFLPRLQG-KLGLYLGLTGYRLRGADVYYSGIATHYCESS 225
            ..:||..:|:.|..||:..||||.| ...|.|..||..:...:....|:.....|.:
Zfish   119 LGLPEVTLGILPAAGGTQRLPRLIGIPAALELITTGRHVSAQEALKLGMVDQVTEQN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HibchNP_732020.2 ECH_2 56..375 CDD:465024 46/187 (25%)
ehhadhNP_996951.1 Enoyl-CoA hydratase / isomerase 2..280 46/187 (25%)
fadJ 11..702 CDD:236864 46/187 (25%)
3-hydroxyacyl-CoA dehydrogenase 281..567
Microbody targeting signal. /evidence=ECO:0000250 716..718
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.