DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg4b and cyp2b6

DIOPT Version :9

Sequence 1:NP_650452.1 Gene:Atg4b / 41868 FlyBaseID:FBgn0038325 Length:668 Species:Drosophila melanogaster
Sequence 2:NP_001096373.1 Gene:cyp2b6 / 100124967 XenbaseID:XB-GENE-5779150 Length:489 Species:Xenopus tropicalis


Alignment Length:241 Identity:49/241 - (20%)
Similarity:76/241 - (31%) Gaps:73/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ICGQDADPLSLPLVEDGAIEEEQAAPIQTIHRTVFAV-PRVPSPSPVSTSGANL------NLKTE 89
            :||.||       |:|..|.          |...|:. |::|....|| .|..|      |.|..
 Frog    78 LCGTDA-------VKDALIN----------HADEFSERPKIPIFEDVS-KGYGLIFSHGENWKVM 124

  Fly    90 NAATATPQRKISTSSRFMNAFSQLYGGGNSGPSCGHVEQHNEEPGDLSANRTPT---KGMESKL- 150
            ...|.|..|.              :|.|..     .:|:...|..|.......:   |..|:.| 
 Frog   125 RRFTLTTLRD--------------FGMGKK-----TIEERICEESDCLVEAFKSYKGKPFENTLI 170

  Fly   151 -----------VAMWHNVKYGWSGKMRQTSFSKEQPVWLLGRCYHRRFTPPVSM----ESSITEL 200
                       :.:.|...|..:..::......|. |.|:|       :|.|.:    .|.:..|
 Frog   171 MNAAVANIIVSILLGHRFDYQDTALLKLIKIINEN-VRLMG-------SPMVMLYNTYPSVMQWL 227

  Fly   201 PSGADTTPDNATSAFDSIQATSTSTSLYPALNPQQ--IDEIVVPQE 244
            |....|..:|....|..::.|.|.......:|.|:  :|..:|.|:
 Frog   228 PGKHKTVAENTLKLFKFLEETFTKHRDQLDVNDQRDLVDTFLVKQQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg4bNP_650452.1 Peptidase_C54 264..565 CDD:281417
cyp2b6NP_001096373.1 p450 31..466 CDD:306555 49/241 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165166911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.