| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_009670.3 | Gene: | CYC8 / 852410 | SGDID: | S000000316 | Length: | 966 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 403 | Identity: | 78/403 - (19%) |
|---|---|---|---|
| Similarity: | 140/403 - (34%) | Gaps: | 120/403 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 420 RQRATDWLNEEQLFKSALQVCP------DNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYE 478
Fly 479 SALMNLGNLYREHGQLSTAEEYIRLAL------------------------QAYPAF-------- 511
Fly 512 ----PAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVC---YYNMGNLYLEQKRYAEALH-- 567
Fly 568 ----------------------------HWQ-------HAVALNPRQPKAWANILTMLDNKGLQ- 596
Fly 597 ---DDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLY 658
Fly 659 HRWDKTQEAIEAYRTAISIS------------------------------AARATT----ARENL 689
Fly 690 SKLLKRLEREAQV 702 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 74/372 (20%) | ||
| TPR_1 | 444..477 | CDD:278916 | 9/32 (28%) | ||
| TPR repeat | 444..472 | CDD:276809 | 8/27 (30%) | ||
| TPR_17 | 466..499 | CDD:290167 | 9/32 (28%) | ||
| TPR repeat | 480..506 | CDD:276809 | 10/49 (20%) | ||
| TPR repeat | 511..541 | CDD:276809 | 9/41 (22%) | ||
| TPR_1 | 512..545 | CDD:278916 | 9/32 (28%) | ||
| TPR_1 | 546..577 | CDD:278916 | 10/70 (14%) | ||
| TPR repeat | 546..574 | CDD:276809 | 9/67 (13%) | ||
| TPR repeat | 580..608 | CDD:276809 | 4/31 (13%) | ||
| TPR repeat | 614..642 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 647..677 | CDD:276809 | 10/29 (34%) | ||
| CYC8 | NP_009670.3 | TPR | <38..142 | CDD:223533 | 22/103 (21%) |
| TPR repeat | 46..74 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 80..108 | CDD:276809 | 9/27 (33%) | ||
| TPR | 94..391 | CDD:223533 | 49/296 (17%) | ||
| TPR repeat | 113..143 | CDD:276809 | 3/29 (10%) | ||
| TPR repeat | 150..178 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 184..211 | CDD:276809 | 6/26 (23%) | ||
| TPR repeat | 223..253 | CDD:276809 | 3/29 (10%) | ||
| TPR repeat | 258..290 | CDD:276809 | 4/31 (13%) | ||
| TPR repeat | 296..324 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 329..359 | CDD:276809 | 10/29 (34%) | ||
| TPR repeat | 364..393 | CDD:276809 | 1/28 (4%) | ||
| Herpes_BLLF1 | <697..944 | CDD:282904 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||