DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and TAH1

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	NP_009986.1	Gene:	TAH1 / 850424	SGDID:	S000000656	Length:	111	Species:	Saccharomyces cerevisiae

Alignment Length:	57	Identity:	15/57 - (26%)
Similarity:	27/57 - (47%)	Gaps:	0/57 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   553 GNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRISNQALQH 609
            ||...:|..|.||:|.:...:...|:.|..::|....|...|....|:::..|.|::
Yeast    11 GNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	15/57 (26%)
		TPR_1	444..477	CDD:278916
		TPR repeat	444..472	CDD:276809
		TPR_17	466..499	CDD:290167
		TPR repeat	480..506	CDD:276809
		TPR repeat	511..541	CDD:276809
		TPR_1	512..545	CDD:278916
		TPR_1	546..577	CDD:278916	7/23 (30%)
		TPR repeat	546..574	CDD:276809	7/20 (35%)
		TPR repeat	580..608	CDD:276809	6/27 (22%)
		TPR repeat	614..642	CDD:276809
		TPR repeat	647..677	CDD:276809
TAH1	NP_009986.1	TPR repeat	8..32	CDD:276809	7/20 (35%)
		C39_PA2778_fam	<11..68	CDD:411481	15/57 (26%)
		TPR repeat	37..67	CDD:276809	7/29 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900