DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and OGT

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_858058.1 Gene:OGT / 8473 HGNCID:8127 Length:1046 Species:Homo sapiens


Alignment Length:300 Identity:91/300 - (30%)
Similarity:143/300 - (47%) Gaps:2/300 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 HWRTALRILLMLLFS-VMMVRTRQRATDWLNEEQLFKSALQVCPDNAKVHYNIARLATDMGNNTK 462
            |:|.|||:....:.. :.:......|.|.....|.:.||||..||...|..::..|...:|...:
Human   111 HYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEE 175

  Fly   463 AFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGK 527
            |...|.:|||..||:..|..|||.::...|::..|..:...|:...|.|..|::|||.|......
Human   176 AKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI 240

  Fly   528 YDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDN 592
            :|:|:|:|.:||....|.||.:.|:..:|.||.....|:..::.|:.|.|..|.|:.|:...|..
Human   241 FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKE 305

  Fly   593 KGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVL 657
            ||...:|....|.||:..|.....|...||:..:..:..||..:|::.:|:.|.....|:||..:
Human   306 KGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASV 370

  Fly   658 YHRWDKTQEAIEAYRTAISISAARATTARENLSKLLKRLE 697
            ..:..|.|||:..|:.||.||...| .|..|:...||.::
Human   371 LQQQGKLQEALMHYKEAIRISPTFA-DAYSNMGNTLKEMQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 78/255 (31%)
TPR_1 444..477 CDD:278916 9/32 (28%)
TPR repeat 444..472 CDD:276809 6/27 (22%)
TPR_17 466..499 CDD:290167 12/32 (38%)
TPR repeat 480..506 CDD:276809 7/25 (28%)
TPR repeat 511..541 CDD:276809 12/29 (41%)
TPR_1 512..545 CDD:278916 11/32 (34%)
TPR_1 546..577 CDD:278916 9/30 (30%)
TPR repeat 546..574 CDD:276809 8/27 (30%)
TPR repeat 580..608 CDD:276809 9/27 (33%)
TPR repeat 614..642 CDD:276809 6/27 (22%)
TPR repeat 647..677 CDD:276809 10/29 (34%)
OGTNP_858058.1 TPR 1 21..54
PEP_TPR_lipo <22..>465 CDD:274350 91/299 (30%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809
TPR 2 89..122 5/10 (50%)
TPR repeat 89..117 CDD:276809 3/5 (60%)
TPR repeat 122..152 CDD:276809 6/29 (21%)
TPR 3 123..156 8/32 (25%)
TPR 4 157..190 9/32 (28%)
TPR repeat 157..185 CDD:276809 6/27 (22%)
TPR 5 191..224 8/32 (25%)
TPR repeat 191..219 CDD:276809 7/27 (26%)
TPR 6 225..258 11/32 (34%)
TPR repeat 226..253 CDD:276809 10/26 (38%)
TPR 7 259..292 10/32 (31%)
TPR repeat 259..287 CDD:276809 8/27 (30%)
TPR 8 293..326 11/32 (34%)
TPR repeat 293..321 CDD:276809 9/27 (33%)
TPR 9 327..360 8/32 (25%)
TPR repeat 327..355 CDD:276809 6/27 (22%)
TPR repeat 360..390 CDD:276809 10/29 (34%)
TPR 10 361..394 12/32 (38%)
TPR 11 395..428 5/15 (33%)
TPR repeat 395..423 CDD:276809 5/15 (33%)
TPR 12 429..462
TPR repeat 429..457 CDD:276809
TPR 13, truncated 463..473
Nuclear localization signal. /evidence=ECO:0000255 487..503
Glyco_transf_41 556..1024 CDD:372753
Required for phosphatidylinositol 3,4,5-triphosphate binding 991..1010
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.