Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_858058.1 | Gene: | OGT / 8473 | HGNCID: | 8127 | Length: | 1046 | Species: | Homo sapiens |
Alignment Length: | 300 | Identity: | 91/300 - (30%) |
---|---|---|---|
Similarity: | 143/300 - (47%) | Gaps: | 2/300 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 399 HWRTALRILLMLLFS-VMMVRTRQRATDWLNEEQLFKSALQVCPDNAKVHYNIARLATDMGNNTK 462
Fly 463 AFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGK 527
Fly 528 YDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDN 592
Fly 593 KGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVL 657
Fly 658 YHRWDKTQEAIEAYRTAISISAARATTARENLSKLLKRLE 697 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 78/255 (31%) | ||
TPR_1 | 444..477 | CDD:278916 | 9/32 (28%) | ||
TPR repeat | 444..472 | CDD:276809 | 6/27 (22%) | ||
TPR_17 | 466..499 | CDD:290167 | 12/32 (38%) | ||
TPR repeat | 480..506 | CDD:276809 | 7/25 (28%) | ||
TPR repeat | 511..541 | CDD:276809 | 12/29 (41%) | ||
TPR_1 | 512..545 | CDD:278916 | 11/32 (34%) | ||
TPR_1 | 546..577 | CDD:278916 | 9/30 (30%) | ||
TPR repeat | 546..574 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 580..608 | CDD:276809 | 9/27 (33%) | ||
TPR repeat | 614..642 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 647..677 | CDD:276809 | 10/29 (34%) | ||
OGT | NP_858058.1 | TPR 1 | 21..54 | ||
PEP_TPR_lipo | <22..>465 | CDD:274350 | 91/299 (30%) | ||
TPR repeat | 24..49 | CDD:276809 | |||
TPR repeat | 57..83 | CDD:276809 | |||
TPR 2 | 89..122 | 5/10 (50%) | |||
TPR repeat | 89..117 | CDD:276809 | 3/5 (60%) | ||
TPR repeat | 122..152 | CDD:276809 | 6/29 (21%) | ||
TPR 3 | 123..156 | 8/32 (25%) | |||
TPR 4 | 157..190 | 9/32 (28%) | |||
TPR repeat | 157..185 | CDD:276809 | 6/27 (22%) | ||
TPR 5 | 191..224 | 8/32 (25%) | |||
TPR repeat | 191..219 | CDD:276809 | 7/27 (26%) | ||
TPR 6 | 225..258 | 11/32 (34%) | |||
TPR repeat | 226..253 | CDD:276809 | 10/26 (38%) | ||
TPR 7 | 259..292 | 10/32 (31%) | |||
TPR repeat | 259..287 | CDD:276809 | 8/27 (30%) | ||
TPR 8 | 293..326 | 11/32 (34%) | |||
TPR repeat | 293..321 | CDD:276809 | 9/27 (33%) | ||
TPR 9 | 327..360 | 8/32 (25%) | |||
TPR repeat | 327..355 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 360..390 | CDD:276809 | 10/29 (34%) | ||
TPR 10 | 361..394 | 12/32 (38%) | |||
TPR 11 | 395..428 | 5/15 (33%) | |||
TPR repeat | 395..423 | CDD:276809 | 5/15 (33%) | ||
TPR 12 | 429..462 | ||||
TPR repeat | 429..457 | CDD:276809 | |||
TPR 13, truncated | 463..473 | ||||
Nuclear localization signal. /evidence=ECO:0000255 | 487..503 | ||||
Glyco_transf_41 | 556..1024 | CDD:372753 | |||
Required for phosphatidylinositol 3,4,5-triphosphate binding | 991..1010 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |