DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and LONRF3

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_005262533.1 Gene:LONRF3 / 79836 HGNCID:21152 Length:811 Species:Homo sapiens


Alignment Length:434 Identity:91/434 - (20%)
Similarity:129/434 - (29%) Gaps:150/434 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 GLMIVPFLPASGIICVGFVIAERTLYVPSI-------GFCLLSIYGFLYWYDS-STENTHWRTAL 404
            |..:.|..|..|....|.|.||.|....:.       ||.....:|||....| |..:|..:..|
Human   118 GEALAPAPPDEGSTASGTVAAEETGAAAAAAATEVWDGFKCRKCHGFLSDPVSLSCGHTFCKLCL 182

  Fly   405 R---------ILLMLLFSVMMVRT-RQRATDWLNEEQLFKSALQVCPDNAKVHYNIARLATDMGN 459
            .         .|..:..|.:||.| |.|..         :.|.|..|...:|:..::.|   :| 
Human   183 ERGRAADRRCALCGVKLSALMVATGRARGA---------RRAGQQPPPPLRVNVVLSGL---LG- 234

  Fly   460 NTKAFQHYHRAIELYPNYESALMNLGN-LYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQS 523
              |.|....||        |.|.:.|| ||||.                                
Human   235 --KLFPGPARA--------SQLRHEGNRLYRER-------------------------------- 257

  Fly   524 AQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILT 588
               :.:.||..|.:|:|...|..:.|.|...:|...:.:..|||..:.|..|.|...||......
Human   258 ---QVEAALLKYNEAVKLAPNDHLLYSNRSQIYFTLESHENALHDAEIACKLRPMGFKAHFRKAQ 319

  Fly   589 MLDNKGLQDDALR------------------------------ISNQALQHLPNDVSILFIRANV 623
            .|...|..::|||                              :...:.:|.|:.:.:|      
Human   320 ALATLGKVEEALREFLYCVSLDGKNKRARCEAQRLLLSFFSPSVPGDSQEHSPDILKLL------ 378

  Fly   624 LGKLKHYTEAEAIYKRVIELEPHN--TLYHTNL-----------------------------GVL 657
               ..|....|.:.....|:..||  .|...||                             |..
Human   379 ---APHPRLKENVESMTTEVTSHNLPRLLQDNLELPHCSSQEEAAARGDGSSLMDPAKVKGDGQQ 440

  Fly   658 YHRWDKTQEAIEAYRTAISISAARATTARENLSKLLKRLEREAQ 701
            :|.  |.||..|....|.|..||.:.|.:.. .|..|..:.|:|
Human   441 HHM--KDQEEEEEKWDATSPKAASSKTGKCQ-EKKRKHCQIESQ 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 62/320 (19%)
TPR_1 444..477 CDD:278916 7/32 (22%)
TPR repeat 444..472 CDD:276809 7/27 (26%)
TPR_17 466..499 CDD:290167 10/33 (30%)
TPR repeat 480..506 CDD:276809 7/26 (27%)
TPR repeat 511..541 CDD:276809 4/29 (14%)
TPR_1 512..545 CDD:278916 5/32 (16%)
TPR_1 546..577 CDD:278916 8/30 (27%)
TPR repeat 546..574 CDD:276809 7/27 (26%)
TPR repeat 580..608 CDD:276809 7/57 (12%)
TPR repeat 614..642 CDD:276809 3/27 (11%)
TPR repeat 647..677 CDD:276809 11/60 (18%)
LONRF3XP_005262533.1 RING 158..195 CDD:302633 7/36 (19%)
TPR_11 242..308 CDD:290150 24/108 (22%)
TPR repeat 243..271 CDD:276809 13/70 (19%)
TPR repeat 276..306 CDD:276809 7/29 (24%)
TPR repeat 311..334 CDD:276809 7/22 (32%)
RING 518..557 CDD:238093
LON_substr_bdg 607..808 CDD:280370
LON 618..796 CDD:271862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.