| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_078801.3 | Gene: | TTC13 / 79573 | HGNCID: | 26204 | Length: | 860 | Species: | Homo sapiens |
| Alignment Length: | 247 | Identity: | 60/247 - (24%) |
|---|---|---|---|
| Similarity: | 96/247 - (38%) | Gaps: | 69/247 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 441 PDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQL-------STAE 498
Fly 499 EYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYA 563
Fly 564 EALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVL---G 625
Fly 626 KLKHYTEAEAIYKRVIELEPHNT-------LYHTNLGVLYHRWDKTQEAIEA 670 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 59/246 (24%) | ||
| TPR_1 | 444..477 | CDD:278916 | 8/32 (25%) | ||
| TPR repeat | 444..472 | CDD:276809 | 5/27 (19%) | ||
| TPR_17 | 466..499 | CDD:290167 | 11/39 (28%) | ||
| TPR repeat | 480..506 | CDD:276809 | 8/32 (25%) | ||
| TPR repeat | 511..541 | CDD:276809 | 8/29 (28%) | ||
| TPR_1 | 512..545 | CDD:278916 | 9/32 (28%) | ||
| TPR_1 | 546..577 | CDD:278916 | 8/30 (27%) | ||
| TPR repeat | 546..574 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 580..608 | CDD:276809 | 0/27 (0%) | ||
| TPR repeat | 614..642 | CDD:276809 | 10/30 (33%) | ||
| TPR repeat | 647..677 | CDD:276809 | 8/31 (26%) | ||
| TTC13 | NP_078801.3 | TPR_11 | 119..>418 | CDD:330823 | 60/247 (24%) |
| TPR 1 | 143..176 | ||||
| TPR repeat | 147..171 | CDD:276809 | |||
| TPR repeat | 179..210 | CDD:276809 | |||
| TPR 2 | 216..248 | 7/31 (23%) | |||
| TPR repeat | 216..244 | CDD:276809 | 5/27 (19%) | ||
| TPR 3 | 249..282 | 9/32 (28%) | |||
| TPR repeat | 249..277 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 282..312 | CDD:276809 | 8/29 (28%) | ||
| TPR 4 | 284..316 | 8/31 (26%) | |||
| TPR 5 | 317..350 | 9/66 (14%) | |||
| TPR repeat | 317..344 | CDD:276809 | 6/26 (23%) | ||
| TPR repeat | 351..379 | CDD:276809 | 10/30 (33%) | ||
| TPR 6 | 352..384 | 12/34 (35%) | |||
| TPR repeat | 385..412 | CDD:276809 | 7/30 (23%) | ||
| TPR 7 | 386..418 | 7/29 (24%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165149863 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||