DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and Ttc32

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_083597.1 Gene:Ttc32 / 75516 MGIID:1922766 Length:148 Species:Mus musculus


Alignment Length:157 Identity:37/157 - (23%)
Similarity:58/157 - (36%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 ARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAW 515
            |.|||.....::.  .:..|.|||..:      :|...| ||...:.|:           ...|:
Mouse    14 AALATAQARFSRG--EFAEARELYSAF------IGQCAR-HGSKCSPED-----------LATAY 58

  Fly   516 MNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQP 580
            .|.|..:.....:.:|:..|..|::...:|.|.|||.|.:......:.|||..::.|:.|||   
Mouse    59 NNRGQTKYFSVDFYEAMDDYTSAIEILPSFEVPYYNRGLIRYRLGYFDEALEDFKKALDLNP--- 120

  Fly   581 KAWANILTMLDNKGLQDDALRISNQAL 607
                         |.||..|.:....|
Mouse   121 -------------GFQDAVLSLKQTIL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 37/157 (24%)
TPR_1 444..477 CDD:278916 8/25 (32%)
TPR repeat 444..472 CDD:276809 5/20 (25%)
TPR_17 466..499 CDD:290167 8/32 (25%)
TPR repeat 480..506 CDD:276809 5/25 (20%)
TPR repeat 511..541 CDD:276809 6/29 (21%)
TPR_1 512..545 CDD:278916 6/32 (19%)
TPR_1 546..577 CDD:278916 10/30 (33%)
TPR repeat 546..574 CDD:276809 9/27 (33%)
TPR repeat 580..608 CDD:276809 5/28 (18%)
TPR repeat 614..642 CDD:276809
TPR repeat 647..677 CDD:276809
Ttc32NP_083597.1 TPR_11 11..86 CDD:290150 19/91 (21%)
TPR 1 12..45 10/39 (26%)
TPR_11 55..120 CDD:290150 17/64 (27%)
TPR 2 55..88 6/32 (19%)
TPR repeat 55..83 CDD:276809 6/27 (22%)
TPR repeat 88..118 CDD:276809 10/29 (34%)
TPR 3 89..122 12/48 (25%)
TPR_1 92..122 CDD:278916 11/45 (24%)
TPR repeat 123..148 CDD:276809 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.