| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011542260.1 | Gene: | KDM6A / 7403 | HGNCID: | 12637 | Length: | 1489 | Species: | Homo sapiens |
| Alignment Length: | 311 | Identity: | 69/311 - (22%) |
|---|---|---|---|
| Similarity: | 116/311 - (37%) | Gaps: | 73/311 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 355 LPASGIICVGFVIAERTLYVPSIGFCLLSIYGFL----------YWYDSSTENTHWRTALRILLM 409
Fly 410 LLFSVMMVRTRQRATDWLNEEQLFKSALQVCPD--NAK-VHYNIA---RLATDMGNNTKAFQ--- 465
Fly 466 -------------------------HYHRAIELYPNY-----------ESALMNLGNLYREH--- 491
Fly 492 --GQLSTAE----EYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYY 550
Fly 551 NMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALR 601 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 48/214 (22%) | ||
| TPR_1 | 444..477 | CDD:278916 | 13/64 (20%) | ||
| TPR repeat | 444..472 | CDD:276809 | 11/59 (19%) | ||
| TPR_17 | 466..499 | CDD:290167 | 12/52 (23%) | ||
| TPR repeat | 480..506 | CDD:276809 | 8/34 (24%) | ||
| TPR repeat | 511..541 | CDD:276809 | 9/29 (31%) | ||
| TPR_1 | 512..545 | CDD:278916 | 9/32 (28%) | ||
| TPR_1 | 546..577 | CDD:278916 | 10/30 (33%) | ||
| TPR repeat | 546..574 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 580..608 | CDD:276809 | 5/22 (23%) | ||
| TPR repeat | 614..642 | CDD:276809 | |||
| TPR repeat | 647..677 | CDD:276809 | |||
| KDM6A | XP_011542260.1 | TPR repeat | 93..121 | CDD:276809 | 6/27 (22%) |
| TPR | 106..399 | CDD:223533 | 60/277 (22%) | ||
| TPR repeat | 129..159 | CDD:276809 | 7/36 (19%) | ||
| TPR_1 | 130..163 | CDD:278916 | 9/39 (23%) | ||
| TPR repeat | 164..194 | CDD:276809 | 8/29 (28%) | ||
| TPR repeat | 205..233 | CDD:276809 | 5/27 (19%) | ||
| TPR repeat | 243..278 | CDD:276809 | 8/36 (22%) | ||
| TPR_17 | 272..303 | CDD:290167 | 10/30 (33%) | ||
| TPR repeat | 285..312 | CDD:276809 | 9/26 (35%) | ||
| TPR repeat | 317..347 | CDD:276809 | 9/29 (31%) | ||
| TPR_1 | 318..351 | CDD:278916 | 10/32 (31%) | ||
| TPR repeat | 352..378 | CDD:276809 | 5/22 (23%) | ||
| JmjC | 1151..1215 | CDD:214721 | |||
| JmjC | 1185..1293 | CDD:202224 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||