DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and Ttc32

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	XP_003750178.1	Gene:	Ttc32 / 684830	RGDID:	1585566	Length:	148	Species:	Rattus norvegicus

Alignment Length:	141	Identity:	33/141 - (23%)
Similarity:	56/141 - (39%)	Gaps:	23/141 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   413 SVMMVRTRQRATDWLNEEQLFKSALQVC--------PDNAKVHYNIARLATDMGNNT-------K 462
            ::.|.:.|....|:....:|:.:.:..|        |::....||      :.|...       :
  Rat    15 ALAMAQARFARGDFTEARELYSAFIGQCASHRSKCSPEDLATAYN------NRGQTKYFSVDFYE 73

  Fly   463 AFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGK 527
            |...|..|||:.||:|....|.|.:....|....|.|..:.||...|||..|.::|  .|:...|
  Rat    74 AMDDYTSAIEILPNFEVPYYNRGLIRYRLGYFDEAVEDFKKALDRNPAFQDAVLSL--KQTILDK 136

  Fly   528 YDKALASYEKA 538
            .:|...:.:|:
  Rat   137 EEKQRRNAQKS 147

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	27/104 (26%)
		TPR_1	444..477	CDD:278916	9/39 (23%)
		TPR repeat	444..472	CDD:276809	6/34 (18%)
		TPR_17	466..499	CDD:290167	11/32 (34%)
		TPR repeat	480..506	CDD:276809	6/25 (24%)
		TPR repeat	511..541	CDD:276809	7/28 (25%)
		TPR_1	512..545	CDD:278916	6/27 (22%)
		TPR_1	546..577	CDD:278916
		TPR repeat	546..574	CDD:276809
		TPR repeat	580..608	CDD:276809
		TPR repeat	614..642	CDD:276809
		TPR repeat	647..677	CDD:276809
Ttc32	XP_003750178.1	TPR_11	14..86	CDD:290150	14/76 (18%)
		TPR repeat	14..48	CDD:276809	5/32 (16%)
		TPR repeat	53..84	CDD:276809	7/36 (19%)
		TPR_11	55..120	CDD:290150	18/70 (26%)
		TPR_1	55..88	CDD:278916	9/38 (24%)
		TPR repeat	89..117	CDD:276809	7/27 (26%)
		TPR_1	92..120	CDD:278916	7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900