| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080590.3 | Gene: | Dnaaf4 / 67685 | MGIID: | 1914935 | Length: | 420 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 34/196 - (17%) |
|---|---|---|---|
| Similarity: | 60/196 - (30%) | Gaps: | 75/196 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 417 VRTRQRATDWLNEEQLFKSALQVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESAL 481
Fly 482 MNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKY----- 541
Fly 542 --RANFAV-CYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRIS 603
Fly 604 N 604 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 30/171 (18%) | ||
| TPR_1 | 444..477 | CDD:278916 | 7/32 (22%) | ||
| TPR repeat | 444..472 | CDD:276809 | 6/27 (22%) | ||
| TPR_17 | 466..499 | CDD:290167 | 3/32 (9%) | ||
| TPR repeat | 480..506 | CDD:276809 | 2/25 (8%) | ||
| TPR repeat | 511..541 | CDD:276809 | 7/29 (24%) | ||
| TPR_1 | 512..545 | CDD:278916 | 8/39 (21%) | ||
| TPR_1 | 546..577 | CDD:278916 | 5/31 (16%) | ||
| TPR repeat | 546..574 | CDD:276809 | 5/28 (18%) | ||
| TPR repeat | 580..608 | CDD:276809 | 6/25 (24%) | ||
| TPR repeat | 614..642 | CDD:276809 | |||
| TPR repeat | 647..677 | CDD:276809 | |||
| Dnaaf4 | NP_080590.3 | Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000250 | 7..103 | ||
| p23_DYX1C1_like | 10..87 | CDD:107226 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 164..212 | ||||
| TPR_11 | 287..351 | CDD:290150 | 19/117 (16%) | ||
| TPR 1 | 288..321 | 12/86 (14%) | |||
| TPR repeat | 288..316 | CDD:276809 | 12/81 (15%) | ||
| TPR repeat | 321..351 | CDD:276809 | 7/29 (24%) | ||
| TPR 2 | 322..355 | 7/32 (22%) | |||
| TPR_1 | 322..351 | CDD:278916 | 7/28 (25%) | ||
| TPR_12 | 324..396 | CDD:290160 | 13/71 (18%) | ||
| TPR repeat | 362..392 | CDD:276809 | 5/29 (17%) | ||
| TPR 3 | 364..397 | 6/45 (13%) | |||
| TPR_1 | 365..397 | CDD:278916 | 6/44 (14%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||