Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016869243.1 | Gene: | SPAG1 / 6674 | HGNCID: | 11212 | Length: | 961 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 61/258 - (23%) |
---|---|---|---|
Similarity: | 97/258 - (37%) | Gaps: | 66/258 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 438 QVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYP-----------NYESALMNLGNLYREH 491
Fly 492 GQLSTAEEYIRLA----------------------LQAYPAFPA-----AW--------MNLGIV 521
Fly 522 QS--AQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWA 584
Fly 585 N-ILTMLDNKGLQ-DDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEP 645 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 61/254 (24%) | ||
TPR_1 | 444..477 | CDD:278916 | 10/43 (23%) | ||
TPR repeat | 444..472 | CDD:276809 | 7/27 (26%) | ||
TPR_17 | 466..499 | CDD:290167 | 10/43 (23%) | ||
TPR repeat | 480..506 | CDD:276809 | 5/47 (11%) | ||
TPR repeat | 511..541 | CDD:276809 | 12/44 (27%) | ||
TPR_1 | 512..545 | CDD:278916 | 13/47 (28%) | ||
TPR_1 | 546..577 | CDD:278916 | 6/30 (20%) | ||
TPR repeat | 546..574 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 580..608 | CDD:276809 | 8/29 (28%) | ||
TPR repeat | 614..642 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 647..677 | CDD:276809 | |||
SPAG1 | XP_016869243.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |