DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and SPAG1

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_016869243.1 Gene:SPAG1 / 6674 HGNCID:11212 Length:961 Species:Homo sapiens


Alignment Length:258 Identity:61/258 - (23%)
Similarity:97/258 - (37%) Gaps:66/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 QVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYP-----------NYESALMNLGNLYREH 491
            ::..|.:.::.|.|......||.:...|..:||:||:|           .||: |...|..|.::
Human   516 EIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLLRRAMAYET-LEQYGKAYVDY 579

  Fly   492 GQLSTAEEYIRLA----------------------LQAYPAFPA-----AW--------MNLGIV 521
            ..:...:..::||                      |...||.||     ||        ...|..
Human   580 KTVLQIDCGLQLANDSVNRLSRILMELDGPNWREKLSPIPAVPASVPLQAWHPAKEMISKQAGDS 644

  Fly   522 QS--AQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWA 584
            .|  .||..|:...   ||||          ..||..:..|.|.:||..:...:.:|.::...:.
Human   645 SSHRQQGITDEKTF---KALK----------EEGNQCVNDKNYKDALSKYSECLKINNKECAIYT 696

  Fly   585 N-ILTMLDNKGLQ-DDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEP 645
            | .|..|  |..| ::|.:..:||||....:|...:.||.....||:|.::.....:||.|:|
Human   697 NRALCYL--KLCQFEEAKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDP 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 61/254 (24%)
TPR_1 444..477 CDD:278916 10/43 (23%)
TPR repeat 444..472 CDD:276809 7/27 (26%)
TPR_17 466..499 CDD:290167 10/43 (23%)
TPR repeat 480..506 CDD:276809 5/47 (11%)
TPR repeat 511..541 CDD:276809 12/44 (27%)
TPR_1 512..545 CDD:278916 13/47 (28%)
TPR_1 546..577 CDD:278916 6/30 (20%)
TPR repeat 546..574 CDD:276809 6/27 (22%)
TPR repeat 580..608 CDD:276809 8/29 (28%)
TPR repeat 614..642 CDD:276809 7/27 (26%)
TPR repeat 647..677 CDD:276809
SPAG1XP_016869243.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.