DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and Ifit1bl1

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001095075.1 Gene:Ifit1bl1 / 667373 MGIID:3650685 Length:470 Species:Mus musculus


Alignment Length:413 Identity:78/413 - (18%)
Similarity:141/413 - (34%) Gaps:125/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 CLLSIYGFLYWYDSSTE-NTH--WRTALRILLMLLFSVMMVRTRQRATDWLNEEQLFKSALQVCP 441
            ||:        |||..| ..|  |:       :::..|.|.....|    ::|.:.|.::..:  
Mouse    17 CLI--------YDSLVELRCHFTWK-------LVIEKVDMPDLEVR----ISETEFFDASYSI-- 60

  Fly   442 DNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESA---LMNLGN---LYREHGQLSTAEEY 500
               .:|..:|.:....|...:|.|....|..|..:.:.:   |:..||   |:...|.|:.|:.|
Mouse    61 ---GMHNLLAYVRHLKGQQEEALQSLKEAEALIQSEQLSKRRLVTWGNCAWLHYHRGSLAEAQVY 122

  Fly   501 IRLALQAYPAFPA---------------AWMNLGIVQSAQGKYDKALASYEKALK-------YRA 543
            :....:....|.:               .|   .:::.....|..|:|.:.||||       |.|
Mouse   123 LDKVEKVCKEFSSPFQYRLECAEMDCEEGW---ALLKCGIQNYKGAMACFAKALKVEPENPEYNA 184

  Fly   544 NFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPR------------------------------ 578
            .:||..|.:.::      ...:|.|.|.||::.|.                              
Mouse   185 GYAVVAYRLDHI------DGTSLQHLQKAVSVKPEDPYLKVLLALKLQDLHKLEEAEKHIEETLP 243

  Fly   579 ----QPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILF----------IRANVLGKLKH 629
                ||..:..:......|||..:||....:|||..|....:.|          |:......::.
Mouse   244 RISSQPYVFGYVAKFYRRKGLVKEALEFLGRALQKQPCSTFLHFQIGLCHKKRLIQIKKASNMQP 308

  Fly   630 YTE-----------AEAIYKRVIELEPHNTLYHTNLGVLYHRWDKTQEAIEAYRTAISISAARAT 683
            ..|           |...:||.:||:|...:.:..|..:|...::.:||.:.::..:::|.....
Mouse   309 RGEDRKRADQSIHLAICHFKRTLELKPTYVMAYVTLAEMYIEKNQLKEAEDNFQKLLNMSNLEDH 373

  Fly   684 TARE------NLSKLLKRLEREA 700
            ..:|      |..:..|:.|..|
Mouse   374 IQQEIHFRYGNFQQYYKKSEEAA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 65/348 (19%)
TPR_1 444..477 CDD:278916 7/32 (22%)
TPR repeat 444..472 CDD:276809 6/27 (22%)
TPR_17 466..499 CDD:290167 9/38 (24%)
TPR repeat 480..506 CDD:276809 8/31 (26%)
TPR repeat 511..541 CDD:276809 9/51 (18%)
TPR_1 512..545 CDD:278916 10/54 (19%)
TPR_1 546..577 CDD:278916 8/30 (27%)
TPR repeat 546..574 CDD:276809 7/27 (26%)
TPR repeat 580..608 CDD:276809 7/27 (26%)
TPR repeat 614..642 CDD:276809 6/48 (13%)
TPR repeat 647..677 CDD:276809 4/29 (14%)
Ifit1bl1NP_001095075.1 TPR_12 62..132 CDD:290160 15/69 (22%)
TPR repeat 63..94 CDD:276809 7/30 (23%)
TPR repeat 99..129 CDD:276809 8/29 (28%)
TPR repeat 144..174 CDD:276809 6/32 (19%)
TPR_16 153..215 CDD:290168 18/67 (27%)
TPR repeat 179..210 CDD:276809 10/36 (28%)
TPR repeat 215..242 CDD:276809 0/26 (0%)
TPR repeat 249..277 CDD:276809 7/27 (26%)
TPR repeat 282..333 CDD:276809 6/50 (12%)
TPR_11 <323..368 CDD:290150 10/44 (23%)
Capsule_synth <330..>434 CDD:304472 13/67 (19%)
TPR repeat 338..365 CDD:276809 4/26 (15%)
TPR repeat 376..405 CDD:276809 5/21 (24%)
TPR repeat 430..461 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.