Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032654.1 | Gene: | ifit8 / 641567 | ZFINID: | ZDB-GENE-051127-17 | Length: | 429 | Species: | Danio rerio |
Alignment Length: | 243 | Identity: | 55/243 - (22%) |
---|---|---|---|
Similarity: | 100/243 - (41%) | Gaps: | 47/243 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 458 GNNTKAFQHYHRAIELYPNYE-SALMNLGNLYREHGQLST---AEEYIRLALQAYPAFPA----- 513
Fly 514 ------AWMNLGIVQSAQGKYDKALASYEKAL-------KYRANFAVCYYNMGNLYLEQ---KRY 562
Fly 563 AE--ALHHWQHAVALNPRQP--------KAWANILTMLDNKGLQDDALRISNQALQHLPNDVSIL 617
Fly 618 FIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLYHRWDKTQ 665 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 55/243 (23%) | ||
TPR_1 | 444..477 | CDD:278916 | 6/18 (33%) | ||
TPR repeat | 444..472 | CDD:276809 | 4/13 (31%) | ||
TPR_17 | 466..499 | CDD:290167 | 11/36 (31%) | ||
TPR repeat | 480..506 | CDD:276809 | 10/28 (36%) | ||
TPR repeat | 511..541 | CDD:276809 | 8/47 (17%) | ||
TPR_1 | 512..545 | CDD:278916 | 7/50 (14%) | ||
TPR_1 | 546..577 | CDD:278916 | 8/35 (23%) | ||
TPR repeat | 546..574 | CDD:276809 | 7/32 (22%) | ||
TPR repeat | 580..608 | CDD:276809 | 7/35 (20%) | ||
TPR repeat | 614..642 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 647..677 | CDD:276809 | 5/19 (26%) | ||
ifit8 | NP_001032654.1 | TPR_12 | 50..117 | CDD:290160 | 17/55 (31%) |
TPR repeat | 206..236 | CDD:276809 | 8/37 (22%) | ||
TPR repeat | 241..269 | CDD:276809 | 5/27 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |