DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and FKBPL

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	NP_071393.2	Gene:	FKBPL / 63943	HGNCID:	13949	Length:	349	Species:	Homo sapiens

Alignment Length:	120	Identity:	25/120 - (20%)
Similarity:	39/120 - (32%)	Gaps:	34/120 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   441 PDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLAL 505
            |:...:|.|:|.....:|....|.|...|.:|..|.:..|      |||.
Human   249 PERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKA------LYRR--------------- 292

  Fly   506 QAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQK 560
                         |:.|:|.|..:||.|..:|.|............:|.:.::.|
Human   293 -------------GVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGK 334

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	24/119 (20%)
		TPR_1	444..477	CDD:278916	9/32 (28%)
		TPR repeat	444..472	CDD:276809	7/27 (26%)
		TPR_17	466..499	CDD:290167	7/32 (22%)
		TPR repeat	480..506	CDD:276809	4/25 (16%)
		TPR repeat	511..541	CDD:276809	9/29 (31%)
		TPR_1	512..545	CDD:278916	9/32 (28%)
		TPR_1	546..577	CDD:278916	2/15 (13%)
		TPR repeat	546..574	CDD:276809	2/15 (13%)
		TPR repeat	580..608	CDD:276809
		TPR repeat	614..642	CDD:276809
		TPR repeat	647..677	CDD:276809
FKBPL	NP_071393.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	36..55
		TPR_11	187..>348	CDD:330823	25/120 (21%)
		TPR 1	210..243
		TPR repeat	210..238	CDD:276809
		TPR repeat	251..281	CDD:276809	7/29 (24%)
		TPR 2	252..285		9/32 (28%)
		TPR 3	286..319		13/66 (20%)
		TPR repeat	286..314	CDD:276809	12/61 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900