DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and BBS4

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_149017.2 Gene:BBS4 / 585 HGNCID:969 Length:519 Species:Homo sapiens


Alignment Length:335 Identity:72/335 - (21%)
Similarity:139/335 - (41%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 SIGFCLLSIYGFLYWYDSSTENTHWRTALRILLMLLFSVMMVRTRQRATDWLNEEQLFKSALQVC 440
            ::|.|    |.:|..::.:.:..|  .||.:....|..:|:.:......|.....:::|.|::..
Human   140 NLGVC----YIYLKQFNKAQDQLH--NALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFS 198

  Fly   441 PDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLAL 505
            |:|.::...:..|...:|...|||:|...|:...|....|::..|::.:.||....|....|:..
Human   199 PENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVA 263

  Fly   506 QAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCY-----YNMGNLYLEQKRYAEA 565
            .|.|..|..|.|:|:....:.||..|::    .|| |||:...:     ||:|.::|..::||.|
Human   264 CAVPESPPLWNNIGMCFFGKKKYVAAIS----CLK-RANYLAPFDWKILYNLGLVHLTMQQYASA 323

  Fly   566 LHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHY 630
            .|....|:...|:..:.:..:...|.|  |:|    |.|                          
Human   324 FHFLSAAINFQPKMGELYMLLAVALTN--LED----IEN-------------------------- 356

  Fly   631 TEAEAIYKRVIELEPHNTLYHTNLGVLYHRWDKTQEAIEAYR-TAISISAARATTARENLSKLLK 694
              |:..|...:.|:..|.|.:.|..||.:...:.:.|:..|: ....:|..:..::.|..|::::
Human   357 --AKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVE 419

  Fly   695 RLEREAQVMQ 704
            ..::....:|
Human   420 MAQKLGAALQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 58/264 (22%)
TPR_1 444..477 CDD:278916 8/32 (25%)
TPR repeat 444..472 CDD:276809 7/27 (26%)
TPR_17 466..499 CDD:290167 8/32 (25%)
TPR repeat 480..506 CDD:276809 6/25 (24%)
TPR repeat 511..541 CDD:276809 8/29 (28%)
TPR_1 512..545 CDD:278916 11/32 (34%)
TPR_1 546..577 CDD:278916 9/35 (26%)
TPR repeat 546..574 CDD:276809 9/32 (28%)
TPR repeat 580..608 CDD:276809 6/27 (22%)
TPR repeat 614..642 CDD:276809 2/27 (7%)
TPR repeat 647..677 CDD:276809 7/30 (23%)
BBS4NP_149017.2 Required for localization to centrosomes 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
TPR_11 <18..400 CDD:330823 68/304 (22%)
TPR repeat 36..61 CDD:276809
TPR 1 67..100
TPR repeat 68..95 CDD:276809
Interaction with PCM1. /evidence=ECO:0000269|PubMed:15107855 101..337 52/207 (25%)
TPR repeat 101..129 CDD:276809
TPR repeat 134..164 CDD:276809 7/29 (24%)
TPR repeat 169..196 CDD:276809 5/26 (19%)
TPR repeat 202..229 CDD:276809 6/26 (23%)
TPR repeat 236..264 CDD:276809 6/27 (22%)
TPR repeat 270..298 CDD:276809 11/32 (34%)
TPR repeat 303..333 CDD:276809 9/29 (31%)
Required for localization to centrosomes 338..519 20/126 (16%)
TPR repeat 338..365 CDD:276809 8/60 (13%)
TPR repeat 372..397 CDD:276809 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.