| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005167851.1 | Gene: | kdm6a / 569277 | ZFINID: | ZDB-GENE-081105-56 | Length: | 1452 | Species: | Danio rerio |
| Alignment Length: | 307 | Identity: | 60/307 - (19%) |
|---|---|---|---|
| Similarity: | 106/307 - (34%) | Gaps: | 98/307 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 379 FCLLSIYGFL----------YWYDSSTENTHWRTALRILLMLLFSVMMVRTRQRATDWLNEEQLF 433
Fly 434 KSALQVCPDNA-------------------------KVHYNIA---RLATDMGNNTKAFQ----- 465
Fly 466 -------------HYHRAIELYPNYESA---------------------LMNLGNLYREHGQL-- 494
Fly 495 -----STAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGN 554
Fly 555 LYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALR 601 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 45/234 (19%) | ||
| TPR_1 | 444..477 | CDD:278916 | 9/78 (12%) | ||
| TPR repeat | 444..472 | CDD:276809 | 8/73 (11%) | ||
| TPR_17 | 466..499 | CDD:290167 | 11/60 (18%) | ||
| TPR repeat | 480..506 | CDD:276809 | 8/53 (15%) | ||
| TPR repeat | 511..541 | CDD:276809 | 9/29 (31%) | ||
| TPR_1 | 512..545 | CDD:278916 | 9/32 (28%) | ||
| TPR_1 | 546..577 | CDD:278916 | 10/30 (33%) | ||
| TPR repeat | 546..574 | CDD:276809 | 8/27 (30%) | ||
| TPR repeat | 580..608 | CDD:276809 | 5/22 (23%) | ||
| TPR repeat | 614..642 | CDD:276809 | |||
| TPR repeat | 647..677 | CDD:276809 | |||
| kdm6a | XP_005167851.1 | TPR | 74..332 | CDD:223533 | 45/247 (18%) |
| TPR repeat | 95..123 | CDD:276809 | 5/24 (21%) | ||
| TPR repeat | 131..176 | CDD:276809 | 9/58 (16%) | ||
| TPR repeat | 181..211 | CDD:276809 | 6/29 (21%) | ||
| TPR repeat | 222..250 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 260..295 | CDD:276809 | 7/34 (21%) | ||
| TPR_17 | 289..320 | CDD:290167 | 9/30 (30%) | ||
| TPR_11 | 302..365 | CDD:290150 | 18/62 (29%) | ||
| TPR repeat | 302..329 | CDD:276809 | 9/26 (35%) | ||
| TPR repeat | 334..364 | CDD:276809 | 9/29 (31%) | ||
| TPR_1 | 335..368 | CDD:278916 | 10/32 (31%) | ||
| TPR repeat | 369..395 | CDD:276809 | 5/22 (23%) | ||
| SSDP | 572..852 | CDD:282372 | |||
| JmjC | 1149..1213 | CDD:214721 | |||
| JmjC | 1183..1291 | CDD:202224 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||