DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and kdm6al

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_005168853.1 Gene:kdm6al / 569207 ZFINID:ZDB-GENE-070112-2002 Length:1356 Species:Danio rerio


Alignment Length:403 Identity:90/403 - (22%)
Similarity:146/403 - (36%) Gaps:105/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 FCLLSIYGFL----------YWYDSSTENTHWRTALRILLMLLFSVMMVRTRQRATDWLNEEQLF 433
            ||.|..:..|          |....|.::.:|:.|     ..|:.:.||.....|..|  ..:.|
Zfish    96 FCQLGHFNLLLEEYPKALSAYQRYYSLQSDYWKNA-----AFLYGLGMVYFHYNAFQW--AIKAF 153

  Fly   434 KSALQVCP--DNAK-VHYNIA---RLATDMGNNTKAFQ---------------------HY---- 467
            :..|.:.|  ..|| :|..:.   ::.||..::.|.||                     |.    
Zfish   154 QEVLYIDPGFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSSRCTLSKAEIQFHIAHLYEIQ 218

  Fly   468 --HRAI-ELY-----------PNYESALMNLGNLYREHGQL-------STAEEYIRLALQAYPAF 511
              |||. |.|           |...:||..||.::....||       |.|.:.::.:|:|.|..
Zfish   219 KRHRAAKEAYESLLQTEDLQTPVRAAALQQLGWMHHTVEQLGDKANKDSYAIQCLQKSLEADPNS 283

  Fly   512 PAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALN 576
            ..:|..||...|:.||...|..||.:::......|..:.::|.||.:|.:..:||..:..||.|:
Zfish   284 GQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLD 348

  Fly   577 PRQPKAWANILTMLDNKGLQDDALR----------ISNQA-----LQHLPNDVSILFIRANVL-G 625
            .....||.::.|:.::.....||::          .||.|     :::|  ......:|.|.| |
Zfish   349 HSHAAAWMDLGTLYESCNQPHDAIKCYINATRSKTCSNTAALAARIKYL--QAQFCKLRLNSLQG 411

  Fly   626 KLKHYTEAEAIYKRVI--ELEPHNTLYHTNLGVLYHRWDKTQ-----------EAIEAYRTAISI 677
            |.|.....|..:...|  ||.....:..|.....     |.|           .|:..:.||:..
Zfish   412 KSKTLPNIEEAWSLPIPAELTSRQGVQSTGPQAC-----KAQPGASSGSQASAPALPPHSTALEP 471

  Fly   678 SAARATTARENLS 690
            :.|:.:.||...|
Zfish   472 AGAQTSPARRRRS 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 74/328 (23%)
TPR_1 444..477 CDD:278916 15/75 (20%)
TPR repeat 444..472 CDD:276809 12/59 (20%)
TPR_17 466..499 CDD:290167 15/57 (26%)
TPR repeat 480..506 CDD:276809 8/32 (25%)
TPR repeat 511..541 CDD:276809 9/29 (31%)
TPR_1 512..545 CDD:278916 9/32 (28%)
TPR_1 546..577 CDD:278916 10/30 (33%)
TPR repeat 546..574 CDD:276809 8/27 (30%)
TPR repeat 580..608 CDD:276809 8/42 (19%)
TPR repeat 614..642 CDD:276809 8/30 (27%)
TPR repeat 647..677 CDD:276809 6/40 (15%)
kdm6alXP_005168853.1 TPR_11 92..161 CDD:290150 15/71 (21%)
TPR repeat 93..121 CDD:276809 5/24 (21%)
TPR_11 129..194 CDD:290150 17/71 (24%)
TPR repeat 129..159 CDD:276809 8/36 (22%)
TPR_1 130..163 CDD:278916 9/39 (23%)
TPR repeat 164..194 CDD:276809 8/29 (28%)
TPR repeat 205..233 CDD:276809 6/27 (22%)
TPR repeat 243..278 CDD:276809 8/34 (24%)
TPR_17 272..303 CDD:290167 9/30 (30%)
TPR_11 285..348 CDD:290150 18/62 (29%)
TPR repeat 285..312 CDD:276809 9/26 (35%)
TPR repeat 317..347 CDD:276809 9/29 (31%)
TPR_1 318..351 CDD:278916 10/32 (31%)
TPR repeat 352..378 CDD:276809 5/25 (20%)
JmjC 1053..1117 CDD:214721
JmjC 1087..1195 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.