| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287801.1 | Gene: | ifit10 / 567441 | ZFINID: | ZDB-GENE-121214-248 | Length: | 482 | Species: | Danio rerio |
| Alignment Length: | 213 | Identity: | 47/213 - (22%) |
|---|---|---|---|
| Similarity: | 77/213 - (36%) | Gaps: | 36/213 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 494 LSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALK----------YRANFAVC 548
Fly 549 YYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRISNQALQHLPND 613
Fly 614 VSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLYHRWDKTQEAIEAYRTAISIS 678
Fly 679 AARATTARENLSKLLKRL 696 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 47/213 (22%) | ||
| TPR_1 | 444..477 | CDD:278916 | |||
| TPR repeat | 444..472 | CDD:276809 | |||
| TPR_17 | 466..499 | CDD:290167 | 1/4 (25%) | ||
| TPR repeat | 480..506 | CDD:276809 | 5/11 (45%) | ||
| TPR repeat | 511..541 | CDD:276809 | 8/39 (21%) | ||
| TPR_1 | 512..545 | CDD:278916 | 10/42 (24%) | ||
| TPR_1 | 546..577 | CDD:278916 | 7/30 (23%) | ||
| TPR repeat | 546..574 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 580..608 | CDD:276809 | 5/27 (19%) | ||
| TPR repeat | 614..642 | CDD:276809 | 5/27 (19%) | ||
| TPR repeat | 647..677 | CDD:276809 | 5/29 (17%) | ||
| ifit10 | NP_001287801.1 | TPR repeat | 58..86 | CDD:276809 | 7/27 (26%) |
| TPR repeat | 91..130 | CDD:276809 | 9/39 (23%) | ||
| TPR repeat | 142..172 | CDD:276809 | 8/54 (15%) | ||
| TPR repeat | 177..213 | CDD:276809 | 6/35 (17%) | ||
| TPR repeat | 251..281 | CDD:276809 | |||
| TPR repeat | 338..362 | CDD:276809 | |||
| TPR repeat | 375..406 | CDD:276809 | |||
| TPR repeat | 411..463 | CDD:276809 | |||
| TPR_1 | 436..468 | CDD:278916 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||