Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001082875.2 | Gene: | spag1a / 564953 | ZFINID: | ZDB-GENE-030131-9443 | Length: | 386 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 56/265 - (21%) |
---|---|---|---|
Similarity: | 95/265 - (35%) | Gaps: | 61/265 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 433 FKSALQVC-------PDNAKVHY-NIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYR 489
Fly 490 EHGQLSTAEEY------------IRLALQA-----------------------YPAFPAAWMNL- 518
Fly 519 ------GIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNP 577
Fly 578 RQPKAWAN-ILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVI 641
Fly 642 ELEPH 646 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 53/249 (21%) | ||
TPR_1 | 444..477 | CDD:278916 | 12/33 (36%) | ||
TPR repeat | 444..472 | CDD:276809 | 9/28 (32%) | ||
TPR_17 | 466..499 | CDD:290167 | 8/32 (25%) | ||
TPR repeat | 480..506 | CDD:276809 | 6/37 (16%) | ||
TPR repeat | 511..541 | CDD:276809 | 7/36 (19%) | ||
TPR_1 | 512..545 | CDD:278916 | 9/39 (23%) | ||
TPR_1 | 546..577 | CDD:278916 | 4/30 (13%) | ||
TPR repeat | 546..574 | CDD:276809 | 3/27 (11%) | ||
TPR repeat | 580..608 | CDD:276809 | 5/28 (18%) | ||
TPR repeat | 614..642 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 647..677 | CDD:276809 | 56/265 (21%) | ||
spag1a | NP_001082875.2 | TPR_11 | 87..157 | CDD:290150 | 14/49 (29%) |
TPR repeat | 87..112 | CDD:276809 | 1/4 (25%) | ||
TPR repeat | 125..155 | CDD:276809 | 9/29 (31%) | ||
TPR_11 | 128..190 | CDD:290150 | 16/67 (24%) | ||
TPR repeat | 160..188 | CDD:276809 | 5/27 (19%) | ||
TPR_11 | 263..326 | CDD:290150 | 12/64 (19%) | ||
TPR repeat | 263..289 | CDD:276809 | 3/26 (12%) | ||
TPR repeat | 294..324 | CDD:276809 | 6/30 (20%) | ||
TPR_11 | 297..360 | CDD:290150 | 16/63 (25%) | ||
TPR_1 | 297..328 | CDD:278916 | 8/31 (26%) | ||
TPR repeat | 329..357 | CDD:276809 | 7/27 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |