DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and Spag1

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster


Alignment Length:247 Identity:52/247 - (21%)
Similarity:91/247 - (36%) Gaps:84/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 RQRATDW----------------LNEEQLFKSALQVCPDNAKVHYNIARLATDMGNNTKAFQHYH 468
            |.::||:                ||||:..:...::..:::|      .:.||...:.:.     
  Fly   154 RIKSTDYRKWDKYDPDEEILRMDLNEERDQEQREKIISNHSK------SVTTDKLQSERD----- 207

  Fly   469 RAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALA 533
               .||...::.|.||..|.:|    ..||   |..|:...:|.|.            :|:.|:.
  Fly   208 ---SLYERLQAQLKNLSQLEKE----QFAE---RHRLRGNESFKAK------------EYENAIE 250

  Fly   534 SYEKALKYRANFAV-CYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQD 597
            .|..::.|....|| .|.|....:|:.|:|..|:...|..:.::|...||               
  Fly   251 EYNCSIIYDPENAVHAYNNRAVAHLKLKKYFSAISDCQACLQIDPMNIKA--------------- 300

  Fly   598 DALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTL 649
             .||:   |..|            |..||   :.|:..:||::::.||.|.:
  Fly   301 -HLRM---AEAH------------NAEGK---HLESLNVYKKLLDFEPDNAI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 45/209 (22%)
TPR_1 444..477 CDD:278916 5/32 (16%)
TPR repeat 444..472 CDD:276809 3/27 (11%)
TPR_17 466..499 CDD:290167 8/32 (25%)
TPR repeat 480..506 CDD:276809 8/25 (32%)
TPR repeat 511..541 CDD:276809 5/29 (17%)
TPR_1 512..545 CDD:278916 5/32 (16%)
TPR_1 546..577 CDD:278916 9/31 (29%)
TPR repeat 546..574 CDD:276809 9/28 (32%)
TPR repeat 580..608 CDD:276809 5/27 (19%)
TPR repeat 614..642 CDD:276809 6/27 (22%)
TPR repeat 647..677 CDD:276809 1/3 (33%)
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 19/80 (24%)
TPR repeat 229..257 CDD:276809 9/42 (21%)
TPR repeat 262..293 CDD:276809 9/30 (30%)
TPR_11 266..329 CDD:290150 20/96 (21%)
TPR 266..297 CDD:197478 8/30 (27%)
TPR repeat 298..326 CDD:276809 12/61 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.