DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and Fkbpl

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	NP_001002818.1	Gene:	Fkbpl / 406168	RGDID:	1303227	Length:	347	Species:	Rattus norvegicus

Alignment Length:	120	Identity:	26/120 - (21%)
Similarity:	40/120 - (33%)	Gaps:	34/120 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   441 PDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLAL 505
            |:...:|.|:|.....:|:...|.|...|.:|..|.:..|      |||.
  Rat   247 PERTILHANLAACQLLLGHPQLAAQSCDRVLEREPGHLKA------LYRR--------------- 290

  Fly   506 QAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQK 560
                         |:.|:|.|..|||.|..:|.|............:|.:.::.|
  Rat   291 -------------GVAQAALGDLDKATADLKKVLAVDPKNRAAKEELGKVVIQGK 332

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	25/119 (21%)
		TPR_1	444..477	CDD:278916	9/32 (28%)
		TPR repeat	444..472	CDD:276809	7/27 (26%)
		TPR_17	466..499	CDD:290167	7/32 (22%)
		TPR repeat	480..506	CDD:276809	4/25 (16%)
		TPR repeat	511..541	CDD:276809	10/29 (34%)
		TPR_1	512..545	CDD:278916	10/32 (31%)
		TPR_1	546..577	CDD:278916	2/15 (13%)
		TPR repeat	546..574	CDD:276809	2/15 (13%)
		TPR repeat	580..608	CDD:276809
		TPR repeat	614..642	CDD:276809
		TPR repeat	647..677	CDD:276809
Fkbpl	NP_001002818.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..36
		TPR_11	208..281	CDD:290150	9/33 (27%)
		TPR 1	208..241
		TPR repeat	208..236	CDD:276809
		TPR repeat	249..279	CDD:276809	7/29 (24%)
		TPR 2	250..283		9/32 (28%)
		TPR_11	252..315	CDD:290150	23/96 (24%)
		TPR 3	284..317		14/66 (21%)
		TPR repeat	284..312	CDD:276809	13/61 (21%)
		TPR_1	285..317	CDD:278916	14/65 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900