DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and Kdm6b

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	XP_038942397.1	Gene:	Kdm6b / 363630	RGDID:	1307629	Length:	1636	Species:	Rattus norvegicus

Alignment Length:	99	Identity:	29/99 - (29%)
Similarity:	47/99 - (47%)	Gaps:	7/99 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   491 HGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNL 555
            ||:|.:....:: ||...||.|..|..||.:..::...::|:..|.:||:|..:||.....:|.|
  Rat    87 HGKLESLHGCVQ-ALLREPAQPVLWEQLGQLYESEHDSEEAICCYHRALRYGGSFAELGPRIGRL 150

  Fly   556 YLEQKRYAEALH--HWQHAVALNPRQPKAWANIL 587
               |:.....||  ..||...:.|...:.| |:|
  Rat   151 ---QQAQLWNLHAGSCQHRAKVLPPLEQVW-NLL 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	29/99 (29%)
		TPR_1	444..477	CDD:278916
		TPR repeat	444..472	CDD:276809
		TPR_17	466..499	CDD:290167	3/7 (43%)
		TPR repeat	480..506	CDD:276809	4/14 (29%)
		TPR repeat	511..541	CDD:276809	8/29 (28%)
		TPR_1	512..545	CDD:278916	9/32 (28%)
		TPR_1	546..577	CDD:278916	8/32 (25%)
		TPR repeat	546..574	CDD:276809	8/29 (28%)
		TPR repeat	580..608	CDD:276809	3/8 (38%)
		TPR repeat	614..642	CDD:276809
		TPR repeat	647..677	CDD:276809
Kdm6b	XP_038942397.1	TPR repeat	106..136	CDD:276809	8/29 (28%)
		JmjC	1336..1400	CDD:214721
		JmjC	1370..1478	CDD:396791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900