Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001255013.1 | Gene: | bbs-4 / 3565681 | WormBaseID: | WBGene00043992 | Length: | 462 | Species: | Caenorhabditis elegans |
Alignment Length: | 325 | Identity: | 75/325 - (23%) |
---|---|---|---|
Similarity: | 123/325 - (37%) | Gaps: | 60/325 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 430 EQLFKSALQVCPDNAKVHYNIA------------------------------------------R 452
Fly 453 LATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLA-LQAY-PAFPAAW 515
Fly 516 MNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQP 580
Fly 581 KAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELE- 644
Fly 645 -PHNTLYHTNLGVLYHRW-DKT--QEAIEAYR----TAISISAARATTARENLSKLLKRLEREAQ 701
Fly 702 701 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 68/311 (22%) | ||
TPR_1 | 444..477 | CDD:278916 | 11/74 (15%) | ||
TPR repeat | 444..472 | CDD:276809 | 9/69 (13%) | ||
TPR_17 | 466..499 | CDD:290167 | 8/32 (25%) | ||
TPR repeat | 480..506 | CDD:276809 | 7/26 (27%) | ||
TPR repeat | 511..541 | CDD:276809 | 7/29 (24%) | ||
TPR_1 | 512..545 | CDD:278916 | 7/32 (22%) | ||
TPR_1 | 546..577 | CDD:278916 | 5/30 (17%) | ||
TPR repeat | 546..574 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 580..608 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 614..642 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 647..677 | CDD:276809 | 7/36 (19%) | ||
bbs-4 | NP_001255013.1 | TPR repeat | 54..83 | CDD:276809 | |
PEP_TPR_lipo | <64..>448 | CDD:274350 | 71/310 (23%) | ||
TPR repeat | 91..117 | CDD:276809 | |||
TPR repeat | 122..152 | CDD:276809 | 5/8 (63%) | ||
TPR repeat | 199..227 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 232..262 | CDD:276809 | 7/31 (23%) | ||
TPR repeat | 267..295 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 303..329 | CDD:276809 | 5/25 (20%) | ||
TPR repeat | 334..364 | CDD:276809 | 6/29 (21%) | ||
TPR repeat | 369..397 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 402..426 | CDD:276809 | 7/26 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |