Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955932.2 | Gene: | tomm34 / 323361 | ZFINID: | ZDB-GENE-030131-2081 | Length: | 305 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 43/203 - (21%) |
---|---|---|---|
Similarity: | 81/203 - (39%) | Gaps: | 22/203 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 463 AFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYI--------RLALQAYPAFP-AAWMNL 518
Fly 519 GIVQSAQGKY-------DKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALN 576
Fly 577 PRQPKAWAN-ILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRV 640
Fly 641 IELEPHNT 648 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 43/203 (21%) | ||
TPR_1 | 444..477 | CDD:278916 | 4/13 (31%) | ||
TPR repeat | 444..472 | CDD:276809 | 3/8 (38%) | ||
TPR_17 | 466..499 | CDD:290167 | 6/32 (19%) | ||
TPR repeat | 480..506 | CDD:276809 | 4/33 (12%) | ||
TPR repeat | 511..541 | CDD:276809 | 8/37 (22%) | ||
TPR_1 | 512..545 | CDD:278916 | 9/40 (23%) | ||
TPR_1 | 546..577 | CDD:278916 | 4/30 (13%) | ||
TPR repeat | 546..574 | CDD:276809 | 3/27 (11%) | ||
TPR repeat | 580..608 | CDD:276809 | 8/28 (29%) | ||
TPR repeat | 614..642 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 647..677 | CDD:276809 | 2/2 (100%) | ||
tomm34 | NP_955932.2 | TPR_11 | 13..83 | CDD:290150 | |
TPR repeat | 13..38 | CDD:276809 | |||
TPR repeat | 43..81 | CDD:276809 | |||
TPR_11 | 54..116 | CDD:290150 | 6/20 (30%) | ||
TPR repeat | 86..114 | CDD:276809 | 5/18 (28%) | ||
TPR_11 | 191..254 | CDD:290150 | 14/67 (21%) | ||
TPR repeat | 191..218 | CDD:276809 | 3/30 (10%) | ||
TPR repeat | 223..253 | CDD:276809 | 9/30 (30%) | ||
TPR_11 | 226..289 | CDD:290150 | 15/63 (24%) | ||
TPR | 226..257 | CDD:197478 | 9/31 (29%) | ||
TPR_1 | 258..291 | CDD:278916 | 7/32 (22%) | ||
TPR repeat | 258..286 | CDD:276809 | 6/27 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |