DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and ifit15

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001288040.1 Gene:ifit15 / 322336 ZFINID:ZDB-GENE-030131-1055 Length:429 Species:Danio rerio


Alignment Length:199 Identity:41/199 - (20%)
Similarity:67/199 - (33%) Gaps:69/199 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 PAAWMN-LGIVQSAQGKYDKALASYEKA----------------LKYRANFAVCYYNMGNL---- 555
            |..:.| ||.:|.:.|...:||.|.:||                |..:||.|..::::|.|    
Zfish    45 PVHYYNLLGFIQKSLGSDREALESLQKAESVIQEQGTEETAVRLLVNKANMAWVHFHLGELEKSR 109

  Fly   556 -YLEQKRYAEALHHWQHAVALNPR--QPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSIL 617
             |||:....:.:|.......|:|.  ..|.|..:......|.|..|                   
Zfish   110 GYLEELEELQRIHPAPPGCPLHPEVSGEKGWTLVKFNKSKKRLAID------------------- 155

  Fly   618 FIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGV------LYHRWDKTQEA--IEAYRTA 674
                              .:|..:|.||....:|..|.:      |:::....|:|  :|..:||
Zfish   156 ------------------YFKMALEAEPERKEWHKGLAISMSKACLWYKCTPEQKAEILEKVKTA 202

  Fly   675 ISIS 678
            ..|:
Zfish   203 AEIN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 41/199 (21%)
TPR_1 444..477 CDD:278916
TPR repeat 444..472 CDD:276809
TPR_17 466..499 CDD:290167
TPR repeat 480..506 CDD:276809
TPR repeat 511..541 CDD:276809 12/45 (27%)
TPR_1 512..545 CDD:278916 13/49 (27%)
TPR_1 546..577 CDD:278916 8/35 (23%)
TPR repeat 546..574 CDD:276809 7/32 (22%)
TPR repeat 580..608 CDD:276809 5/27 (19%)
TPR repeat 614..642 CDD:276809 1/27 (4%)
TPR repeat 647..677 CDD:276809 8/37 (22%)
ifit15NP_001288040.1 TPR_11 <50..>368 CDD:330823 40/194 (21%)
TPR repeat 323..356 CDD:276809
TPR repeat 361..390 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.