DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc4 and Tomm34

DIOPT Version :10

Sequence 1:NP_650451.1 Gene:Tmtc4 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001037709.1 Gene:Tomm34 / 311621 RGDID:1309029 Length:309 Species:Rattus norvegicus


Alignment Length:259 Identity:50/259 - (19%)
Similarity:85/259 - (32%) Gaps:78/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 SALQVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEE 499
            |||.:.|.:.|.....|.....:...:.|:..|...:::..:..|||..:..:.|.... |...|
  Rat    76 SALALVPFSIKPLLRRASAYEALEKYSLAYVDYKTVLQIDNSVASALEGINRITRALMD-SLGPE 139

  Fly   500 YIRLALQAYPAFPAA----WMNL--------------------------GIVQSA---------- 524
            : ||.|...|..|.:    |.:|                          |.|:.|          
  Rat   140 W-RLKLPPIPVVPVSAQKRWSSLPSENHKETAKSKSKETTATKNRVPSAGDVERARVLKEEGNEL 203

  Fly   525 --QGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANIL 587
              :|.:.||:..|.::|.:.:..:..|.|....:|..|:|.||......|:.|:.:..||:    
  Rat   204 VKKGNHKKAIEKYSESLLFSSLESATYSNRALCHLVLKQYKEAEKDCTEALKLDGKNVKAF---- 264

  Fly   588 TMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYH 651
                                          :.||.....||.|..:.|....::::||.|...|
  Rat   265 ------------------------------YRRAQAYKALKDYKSSLADISSLLQIEPRNGPAH 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc4NP_650451.1 TMTC_DUF1736 258..331 CDD:462468
LapB 431..675 CDD:442196 50/259 (19%)
TPR repeat 444..472 CDD:276809 4/27 (15%)
TPR repeat 480..506 CDD:276809 7/25 (28%)
TPR repeat 511..541 CDD:276809 11/71 (15%)
TPR repeat 546..574 CDD:276809 8/27 (30%)
TPR repeat 580..608 CDD:276809 2/27 (7%)
TPR repeat 614..642 CDD:276809 6/27 (22%)
TPR repeat 647..677 CDD:276809 2/5 (40%)
Tomm34NP_001037709.1 TPR 1 9..42
TPR repeat 9..37 CDD:276809
3a0801s09 <11..>294 CDD:273380 48/253 (19%)
TPR repeat 50..80 CDD:276809 3/3 (100%)
TPR 2 51..84 4/7 (57%)
TPR repeat 85..113 CDD:276809 4/27 (15%)
TPR 3 86..118 4/31 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..187 2/28 (7%)
TPR 4 193..226 6/32 (19%)
TPR repeat 193..221 CDD:276809 5/27 (19%)
TPR repeat 226..256 CDD:276809 8/29 (28%)
TPR 5 227..260 9/32 (28%)
TPR repeat 261..289 CDD:276809 8/61 (13%)
TPR 6 262..294 10/65 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.