Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036552.1 | Gene: | IFIT5 / 24138 | HGNCID: | 13328 | Length: | 482 | Species: | Homo sapiens |
Alignment Length: | 264 | Identity: | 63/264 - (23%) |
---|---|---|---|
Similarity: | 104/264 - (39%) | Gaps: | 78/264 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 QRATDWLNEEQLFKSALQVCPDNAKVHYNIA----------RLATDMGNNTK------------- 462
Fly 463 AFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGK 527
Fly 528 YDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAE--ALHHWQHAVALNPRQPKAWANILTML 590
Fly 591 DNKGLQDDAL-RISNQALQHLPNDVSILFIRANVLG---KLK-HYTEAEAIYKRVIELEPHNTLY 650
Fly 651 HTNL 654 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 55/243 (23%) | ||
TPR_1 | 444..477 | CDD:278916 | 9/55 (16%) | ||
TPR repeat | 444..472 | CDD:276809 | 8/50 (16%) | ||
TPR_17 | 466..499 | CDD:290167 | 12/32 (38%) | ||
TPR repeat | 480..506 | CDD:276809 | 12/25 (48%) | ||
TPR repeat | 511..541 | CDD:276809 | 1/29 (3%) | ||
TPR_1 | 512..545 | CDD:278916 | 2/32 (6%) | ||
TPR_1 | 546..577 | CDD:278916 | 9/32 (28%) | ||
TPR repeat | 546..574 | CDD:276809 | 9/29 (31%) | ||
TPR repeat | 580..608 | CDD:276809 | 6/28 (21%) | ||
TPR repeat | 614..642 | CDD:276809 | 8/31 (26%) | ||
TPR repeat | 647..677 | CDD:276809 | 3/8 (38%) | ||
IFIT5 | NP_036552.1 | TPR_12 | 49..116 | CDD:315987 | |
TPR 1 | 51..84 | ||||
TPR repeat | 53..79 | CDD:276809 | |||
TPR repeat | 84..133 | CDD:276809 | |||
TPR 2 | 94..127 | ||||
TPR 3 | 138..173 | ||||
TPR repeat | 138..168 | CDD:276809 | |||
PEP_TPR_lipo | <157..470 | CDD:274350 | 61/257 (24%) | ||
TPR 4 | 181..214 | ||||
TPR repeat | 214..244 | CDD:276809 | |||
TPR 5 | 249..282 | 8/21 (38%) | |||
TPR repeat | 249..277 | CDD:276809 | 5/16 (31%) | ||
Interaction with the 5'-triphosphate group of PPP-RNA | 254..260 | 63/264 (24%) | |||
TPR repeat | 282..333 | CDD:276809 | 8/52 (15%) | ||
TPR 6 | 338..371 | 14/57 (25%) | |||
TPR repeat | 338..366 | CDD:276809 | 12/27 (44%) | ||
TPR 7 | 376..410 | 9/39 (23%) | |||
TPR repeat | 376..405 | CDD:276809 | 9/34 (26%) | ||
TPR 8 | 435..468 | 9/36 (25%) | |||
TPR repeat | 435..463 | CDD:276809 | 8/31 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |