DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc4 and KDM6B

DIOPT Version :10

Sequence 1:NP_650451.1 Gene:Tmtc4 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001073893.1 Gene:KDM6B / 23135 HGNCID:29012 Length:1682 Species:Homo sapiens


Alignment Length:104 Identity:28/104 - (26%)
Similarity:43/104 - (41%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 HGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNL 555
            ||:|.:....:: ||...||.|..|..||.:..::...::|...|..||:|..:||.....:|.|
Human    87 HGKLESLHGCVQ-ALLREPAQPGLWEQLGQLYESEHDSEEATRCYHSALRYGGSFAELGPRIGRL 150

  Fly   556 YLEQKRYAEALHHW-------QHAVALNPRQPKAWANIL 587
            ...|.        |       ||...:.|...:.| |:|
Human   151 QQAQL--------WNFHTGSCQHRAKVLPPLEQVW-NLL 180

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Tmtc4NP_650451.1 TMTC_DUF1736 258..331 CDD:462468
LapB 431..675 CDD:442196 28/104 (27%)
TPR repeat 444..472 CDD:276809
TPR repeat 480..506 CDD:276809 4/14 (29%)
TPR repeat 511..541 CDD:276809 8/29 (28%)
TPR repeat 546..574 CDD:276809 7/34 (21%)
TPR repeat 580..608 CDD:276809 3/8 (38%)
TPR repeat 614..642 CDD:276809
TPR repeat 647..677 CDD:276809