DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and Kdm6b

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_030101676.1 Gene:Kdm6b / 216850 MGIID:2448492 Length:1642 Species:Mus musculus


Alignment Length:104 Identity:28/104 - (26%)
Similarity:45/104 - (43%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 HGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNL 555
            ||:|.:....:: ||...||.|..|..||.:..::...::|:..|.:||:|..:||.....:|.|
Mouse    87 HGKLESLHGCVQ-ALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRL 150

  Fly   556 YLEQKRYAEALHHW-------QHAVALNPRQPKAWANIL 587
            ...|.        |       ||...:.|...:.| |:|
Mouse   151 QQAQL--------WNFHAGSCQHRAKVLPPLEQVW-NLL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594
TPR 442..701 CDD:223533 28/104 (27%)
TPR_1 444..477 CDD:278916
TPR repeat 444..472 CDD:276809
TPR_17 466..499 CDD:290167 3/7 (43%)
TPR repeat 480..506 CDD:276809 4/14 (29%)
TPR repeat 511..541 CDD:276809 8/29 (28%)
TPR_1 512..545 CDD:278916 9/32 (28%)
TPR_1 546..577 CDD:278916 7/37 (19%)
TPR repeat 546..574 CDD:276809 7/34 (21%)
TPR repeat 580..608 CDD:276809 3/8 (38%)
TPR repeat 614..642 CDD:276809
TPR repeat 647..677 CDD:276809
Kdm6bXP_030101676.1 TPR repeat 106..136 CDD:276809 8/29 (28%)
JmjC 1342..1406 CDD:214721
JmjC 1376..1484 CDD:396791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.