DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5038 and utx-1

DIOPT Version :9

Sequence 1:NP_650451.1 Gene:CG5038 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001309685.1 Gene:utx-1 / 181110 WormBaseID:WBGene00017046 Length:1146 Species:Caenorhabditis elegans


Alignment Length:506 Identity:99/506 - (19%)
Similarity:163/506 - (32%) Gaps:169/506 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 FETPTFKEVDNPVAHNEHVLTRGLSQQYLLVMNIWLMLCPHWLCYDWALGCVKLVTNIWDLRLQG 322
            ::|..:|.::..:.:       ||::|                |:      |.|:.|.|    .|
 Worm    88 YKTHKYKTIERRIFY-------GLAKQ----------------CH------VVLLANDW----TG 119

  Fly   323 VIGFYSIVLVALMN-FRRLPGMMLALGLMIVPFLPASGIICVGFVIAERTLYVPSIGFCLLSIYG 386
            .:..|..||....: |...|.|...|||:.:.|                                
 Worm   120 ALELYQEVLSHHPDLFSHDPSMYFGLGLVYLHF-------------------------------- 152

  Fly   387 FLYWYDSSTENTHWRTALRILLMLLFS------VMMVRTR-----QRATDWLNEEQLFKSALQVC 440
                       ..|:.|:.....||:|      .:..:.|     ....|:.....|||.|:...
 Worm   153 -----------KQWKPAIEAFTRLLYSFPTGMIALQAKVRLGVCYMELEDYNRCINLFKLAVNDS 206

  Fly   441 PDNA-----KVHYNIA---------RLATDMGNN--TKAFQHY----------HRAIELYPNYES 479
            .::.     .:.||||         .:|.....|  |:..||.          .:.::|..:.::
 Worm   207 DESVFMPKFTIKYNIALSHENNDELEIAESEYENLITELTQHISFLQSKSNVDQQQVDLLISVKA 271

  Fly   480 A-LMNLGNL-YR----------EHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQ-------SAQ 525
            | |..:|.: ||          :|  |..|:|.:..|....|....::..||.|.       |.|
 Worm   272 ACLRQIGWISYRRSYKDDANRLDH--LKKAQENLISAHDTDPRDGQSYYYLGRVYGEHEPSVSGQ 334

  Fly   526 GKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTML 590
            ..:| |..:|..::..:...|..:.::|.||..|.:..:||..:..|:.||.....||.::..:.
 Worm   335 VAHD-AFVNYRFSIDKKEQNADTWCSIGALYQRQNQPIDALQAFICAIELNSTHSAAWTDLGELY 398

  Fly   591 DNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLG 655
            :......|||.....|:  |.|.|:...|:|.|     .:.|.|  ....:...|.|        
 Worm   399 EKNAQYQDALECFKNAM--LNNPVAPEPIKARV-----QFLEKE--LSMPVPARPSN-------- 446

  Fly   656 VLYHRWDKTQEAI-----EAYRTAISISAARATTARENLSKLLKRLEREAQ 701
               |....|.|.:     |||...|.:.......|        ...:||||
 Worm   447 ---HASSSTFETVIPSLKEAYEQPIPLELRNRQDA--------AYADREAQ 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5038NP_650451.1 DUF1736 258..331 CDD:285594 12/72 (17%)
TPR 442..701 CDD:223533 65/308 (21%)
TPR_1 444..477 CDD:278916 10/58 (17%)
TPR repeat 444..472 CDD:276809 9/53 (17%)
TPR_17 466..499 CDD:290167 10/54 (19%)
TPR repeat 480..506 CDD:276809 10/37 (27%)
TPR repeat 511..541 CDD:276809 8/36 (22%)
TPR_1 512..545 CDD:278916 8/39 (21%)
TPR_1 546..577 CDD:278916 9/30 (30%)
TPR repeat 546..574 CDD:276809 8/27 (30%)
TPR repeat 580..608 CDD:276809 6/27 (22%)
TPR repeat 614..642 CDD:276809 6/27 (22%)
TPR repeat 647..677 CDD:276809 8/34 (24%)
utx-1NP_001309685.1 TPR_11 138..204 CDD:290150 17/108 (16%)
TPR repeat 138..168 CDD:276809 10/72 (14%)
TPR repeat 176..203 CDD:276809 5/26 (19%)
TPR repeat 271..301 CDD:276809 8/31 (26%)
TPR repeat 315..348 CDD:276809 8/33 (24%)
TPR_11 353..419 CDD:290150 17/67 (25%)
TPR repeat 353..383 CDD:276809 8/29 (28%)
TPR_1 354..387 CDD:278916 10/32 (31%)
TPR repeat 388..415 CDD:276809 5/26 (19%)
TPR 390..419 CDD:197478 7/30 (23%)
JmjC 845..909 CDD:214721
JmjC 879..987 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.