DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and LONRF2

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	NP_940863.3	Gene:	LONRF2 / 164832	HGNCID:	24788	Length:	754	Species:	Homo sapiens

Alignment Length:	146	Identity:	30/146 - (20%)
Similarity:	53/146 - (36%)	Gaps:	45/146 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   578 RQPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIE 642
            :||:|                ||...:|||:..|:|.|:|.:||.:...:|:|.:|........:
Human   211 QQPEA----------------ALLRCDQALELAPDDNSLLLLRAELYLTMKNYEQALQDASAACQ 259

  Fly   643 LEP-----HNTLYHTNLGVLYHRWDKTQEAI------------------EAYRTAISISAARATT 684
            .||     |........|:     .:::|.:                  ||.:....:..:....
Human   260 NEPLLIKGHQVKAQALSGL-----GRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATAN 319

  Fly   685 ARENL-SKLLKRLERE 699
            ..||| |.:..||:.:
Human   320 VHENLTSSIQSRLKAQ 335

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	30/146 (21%)
		TPR_1	444..477	CDD:278916
		TPR repeat	444..472	CDD:276809
		TPR_17	466..499	CDD:290167
		TPR repeat	480..506	CDD:276809
		TPR repeat	511..541	CDD:276809
		TPR_1	512..545	CDD:278916
		TPR_1	546..577	CDD:278916
		TPR repeat	546..574	CDD:276809
		TPR repeat	580..608	CDD:276809	6/27 (22%)
		TPR repeat	614..642	CDD:276809	7/27 (26%)
		TPR repeat	647..677	CDD:276809	4/47 (9%)
LONRF2	NP_940863.3	TPR 1	23..58
		TPR_16	27..92	CDD:372602
		TPR 2	59..91
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	112..136
		RING1-HC_LONFs	143..174	CDD:319427
		TPR 3	197..230		9/34 (26%)
		TPR repeat	200..225	CDD:276809	7/29 (24%)
		TPR repeat	230..260	CDD:276809	8/29 (28%)
		TPR 4	231..264		9/32 (28%)
		TPR repeat	265..293	CDD:276809	3/32 (9%)
		TPR 5	266..298		3/36 (8%)
		PEX10	<380..489	CDD:227861
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	398..439
		RING2-HC_LONFs	446..487	CDD:319428
		TPR 6	447..483
		RING-HC finger (C3HC4-type)	449..486	CDD:319428
		LON_substr_bdg	538..738	CDD:366967
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900