Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_570722.2 | Gene: | DNAAF4 / 161582 | HGNCID: | 21493 | Length: | 420 | Species: | Homo sapiens |
Alignment Length: | 249 | Identity: | 53/249 - (21%) |
---|---|---|---|
Similarity: | 99/249 - (39%) | Gaps: | 53/249 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 EEQLFKSALQVCPDNAKVHY-----NIA--RLATDMGNNTKAFQHYHRAIELYPNYESALMNLGN 486
Fly 487 L------------YREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKAL 539
Fly 540 KYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWAN-ILTMLDNKGLQDDALRIS 603
Fly 604 NQALQHL---PNDVSILFIRANV-----LGKLKHYTEAEAIYKRVIELEPHNTL 649 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 49/236 (21%) | ||
TPR_1 | 444..477 | CDD:278916 | 9/39 (23%) | ||
TPR repeat | 444..472 | CDD:276809 | 8/34 (24%) | ||
TPR_17 | 466..499 | CDD:290167 | 6/44 (14%) | ||
TPR repeat | 480..506 | CDD:276809 | 7/37 (19%) | ||
TPR repeat | 511..541 | CDD:276809 | 5/29 (17%) | ||
TPR_1 | 512..545 | CDD:278916 | 5/32 (16%) | ||
TPR_1 | 546..577 | CDD:278916 | 6/30 (20%) | ||
TPR repeat | 546..574 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 580..608 | CDD:276809 | 8/28 (29%) | ||
TPR repeat | 614..642 | CDD:276809 | 6/32 (19%) | ||
TPR repeat | 647..677 | CDD:276809 | 1/3 (33%) | ||
DNAAF4 | NP_570722.2 | Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 | 7..103 | ||
p23_DYX1C1_like | 10..87 | CDD:107226 | |||
TPR_11 | 289..353 | CDD:290150 | 17/77 (22%) | ||
TPR 1 | 290..323 | 8/45 (18%) | |||
TPR repeat | 290..318 | CDD:276809 | 6/40 (15%) | ||
TPR repeat | 323..353 | CDD:276809 | 9/30 (30%) | ||
TPR 2 | 324..357 | 10/33 (30%) | |||
TPR repeat | 364..394 | CDD:276809 | 6/29 (21%) | ||
TPR 3 | 366..399 | 7/32 (22%) | |||
TPR_1 | 367..399 | CDD:278916 | 7/31 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |