| Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001342191.1 | Gene: | Ifit2 / 15958 | MGIID: | 99449 | Length: | 470 | Species: | Mus musculus |
| Alignment Length: | 200 | Identity: | 41/200 - (20%) |
|---|---|---|---|
| Similarity: | 80/200 - (40%) | Gaps: | 27/200 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 480 ALMNLGN---LYREHGQLSTAEEYIRLALQAYPAF--------PA-----AWMNLGIVQSAQGK- 527
Fly 528 ---YDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTM 589
Fly 590 LDNKGL-QDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTN 653
Fly 654 LGVLY 658 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
| TPR | 442..701 | CDD:223533 | 40/199 (20%) | ||
| TPR_1 | 444..477 | CDD:278916 | |||
| TPR repeat | 444..472 | CDD:276809 | |||
| TPR_17 | 466..499 | CDD:290167 | 8/21 (38%) | ||
| TPR repeat | 480..506 | CDD:276809 | 9/28 (32%) | ||
| TPR repeat | 511..541 | CDD:276809 | 9/46 (20%) | ||
| TPR_1 | 512..545 | CDD:278916 | 8/41 (20%) | ||
| TPR_1 | 546..577 | CDD:278916 | 5/30 (17%) | ||
| TPR repeat | 546..574 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 580..608 | CDD:276809 | 4/28 (14%) | ||
| TPR repeat | 614..642 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 647..677 | CDD:276809 | 3/11 (27%) | ||
| Ifit2 | NP_001342191.1 | TPR 1 | 51..89 | ||
| TPR 2 | 90..135 | 11/41 (27%) | |||
| TPR repeat | 96..122 | CDD:276809 | 8/25 (32%) | ||
| TPR repeat | 127..167 | CDD:276809 | 8/39 (21%) | ||
| TPR 3 | 136..171 | 7/34 (21%) | |||
| PEP_TPR_lipo | <145..359 | CDD:274350 | 26/147 (18%) | ||
| TPR 4 | 172..208 | 6/41 (15%) | |||
| TPR 5 | 242..275 | 6/32 (19%) | |||
| TPR repeat | 242..270 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 275..325 | CDD:276809 | 3/11 (27%) | ||
| TPR 6 | 276..331 | 2/10 (20%) | |||
| TPR repeat | 330..358 | CDD:276809 | |||
| TPR 7 | 332..362 | ||||
| TPR 8 | 363..401 | ||||
| TPR 9 | 402..443 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 439..470 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||