DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc4 and TTC32

DIOPT Version :10

Sequence 1:NP_650451.1 Gene:Tmtc4 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001008238.1 Gene:TTC32 / 130502 HGNCID:32954 Length:151 Species:Homo sapiens


Alignment Length:144 Identity:32/144 - (22%)
Similarity:55/144 - (38%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 ALMNLGNLYREHGQLSTAE----EYIRLALQAYPA------------FPAAWMNLGIVQSAQGKY 528
            |.:.|...:..:|:.:.||    .|||....|..:            ...|:.|.|.::..:..:
Human    10 ATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDF 74

  Fly   529 DKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNK 593
            .:|:..|..|::.:.||.|.|||.|.:......:.:||..::..:.|||                
Human    75 YEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNP---------------- 123

  Fly   594 GLQDDALRISNQAL 607
            |.||..|.:....|
Human   124 GFQDATLSLKQTIL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc4NP_650451.1 TMTC_DUF1736 258..331 CDD:462468
LapB 431..675 CDD:442196 32/144 (22%)
TPR repeat 444..472 CDD:276809
TPR repeat 480..506 CDD:276809 8/29 (28%)
TPR repeat 511..541 CDD:276809 6/29 (21%)
TPR repeat 546..574 CDD:276809 7/27 (26%)
TPR repeat 580..608 CDD:276809 5/28 (18%)
TPR repeat 614..642 CDD:276809
TPR repeat 647..677 CDD:276809
TTC32NP_001008238.1 TPR 1 8..41 8/30 (27%)
NlpI <14..132 CDD:443815 30/133 (23%)
TPR repeat 57..87 CDD:276809 6/29 (21%)
TPR 2 58..91 6/32 (19%)
TPR 3 92..125 10/48 (21%)
TPR repeat 92..120 CDD:276809 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.