Sequence 1: | NP_650451.1 | Gene: | CG5038 / 41867 | FlyBaseID: | FBgn0038324 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006800.2 | Gene: | TOMM34 / 10953 | HGNCID: | 15746 | Length: | 309 | Species: | Homo sapiens |
Alignment Length: | 255 | Identity: | 50/255 - (19%) |
---|---|---|---|
Similarity: | 83/255 - (32%) | Gaps: | 78/255 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 435 SALQVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEE 499
Fly 500 YIRLALQAYPAFPAA----WMNL--------------------------GIVQSA---------- 524
Fly 525 --QGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANIL 587
Fly 588 TMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHN 647 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5038 | NP_650451.1 | DUF1736 | 258..331 | CDD:285594 | |
TPR | 442..701 | CDD:223533 | 46/248 (19%) | ||
TPR_1 | 444..477 | CDD:278916 | 4/32 (13%) | ||
TPR repeat | 444..472 | CDD:276809 | 4/27 (15%) | ||
TPR_17 | 466..499 | CDD:290167 | 6/32 (19%) | ||
TPR repeat | 480..506 | CDD:276809 | 6/25 (24%) | ||
TPR repeat | 511..541 | CDD:276809 | 11/71 (15%) | ||
TPR_1 | 512..545 | CDD:278916 | 11/74 (15%) | ||
TPR_1 | 546..577 | CDD:278916 | 10/30 (33%) | ||
TPR repeat | 546..574 | CDD:276809 | 9/27 (33%) | ||
TPR repeat | 580..608 | CDD:276809 | 2/27 (7%) | ||
TPR repeat | 614..642 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 647..677 | CDD:276809 | 1/1 (100%) | ||
TOMM34 | NP_006800.2 | TPR 1 | 9..42 | ||
TPR repeat | 9..37 | CDD:276809 | |||
PLN03088 | <12..>294 | CDD:330826 | 49/253 (19%) | ||
TPR repeat | 50..80 | CDD:276809 | 3/3 (100%) | ||
TPR 2 | 51..84 | 4/7 (57%) | |||
TPR repeat | 85..113 | CDD:276809 | 4/27 (15%) | ||
TPR 3 | 86..118 | 4/31 (13%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..189 | 1/27 (4%) | |||
TPR 4 | 193..226 | 6/32 (19%) | |||
TPR repeat | 193..221 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 226..256 | CDD:276809 | 9/29 (31%) | ||
TPR 5 | 227..260 | 10/32 (31%) | |||
TPR repeat | 261..289 | CDD:276809 | 8/61 (13%) | ||
TPR 6 | 262..294 | 10/65 (15%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |