DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5038 and fkbpl

DIOPT Version :9

Sequence 1:	NP_650451.1	Gene:	CG5038 / 41867	FlyBaseID:	FBgn0038324	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	XP_001923918.1	Gene:	fkbpl / 100149636	ZFINID:	ZDB-GENE-030131-4744	Length:	361	Species:	Danio rerio

Alignment Length:	136	Identity:	28/136 - (20%)
Similarity:	48/136 - (35%)	Gaps:	44/136 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   522 QSAQGKYDKALASYE-KALK--YRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAW 583
            :.|:...|..:.:.| |.:|  ...|.::|...:|.|...:....:       |..|||:..|||
Zfish   244 EGAESPNDSTIPNEEYKTVKAELHCNLSLCQLKLGQLGKSKDSSIK-------ATELNPKSTKAW 301

  Fly   584 ANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNT 648
                            .|.....||               ||:|:   |:...:.:::||:|.:.
Zfish   302 ----------------YRHGQACLQ---------------LGELE---ESRMAFGKILELQPDSA 332

  Fly   649 LYHTNL 654
            ...|.|
Zfish   333 SARTAL 338

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5038	NP_650451.1	DUF1736	258..331	CDD:285594
		TPR	442..701	CDD:223533	28/136 (21%)
		TPR_1	444..477	CDD:278916
		TPR repeat	444..472	CDD:276809
		TPR_17	466..499	CDD:290167
		TPR repeat	480..506	CDD:276809
		TPR repeat	511..541	CDD:276809	5/21 (24%)
		TPR_1	512..545	CDD:278916	5/25 (20%)
		TPR_1	546..577	CDD:278916	5/30 (17%)
		TPR repeat	546..574	CDD:276809	4/27 (15%)
		TPR repeat	580..608	CDD:276809	4/27 (15%)
		TPR repeat	614..642	CDD:276809	4/27 (15%)
		TPR repeat	647..677	CDD:276809	2/8 (25%)
fkbpl	XP_001923918.1	TPR_11	263..329	CDD:290150	21/106 (20%)
		TPR repeat	264..292	CDD:276809	5/34 (15%)
		TPR repeat	297..327	CDD:276809	10/63 (16%)
		TPR_8	299..330	CDD:289924	12/64 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900