DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and AT3G05000

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_187151.1 Gene:AT3G05000 / 819661 AraportID:AT3G05000 Length:173 Species:Arabidopsis thaliana


Alignment Length:169 Identity:67/169 - (39%)
Similarity:96/169 - (56%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIVNYCLD---------------SNKEHDLAT--LEYIGFTTGYRLIERLTREVSRFKDELETMK 60
            |:...|:|               :||. :||.  :|.||:..|::|.||.|.|..||.|.||.:|
plant     4 EVAESCVDTMLMEMVAMYSGRFYANKP-ELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIK 67

  Fly    61 FICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRIS--------------PG-TKQLEHAP 110
            |||.|||..::|||:|||:||:.|.:|:||..||:|:|:|              || :|..:...
plant    68 FICKDFWSEVFKKQIDNLKTNHRGTFVLQDNKFRWLSRVSIDPSSENETQDPSTPGESKAAQAVS 132

  Fly   111 KFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEV 149
            .::.|.||::||.||||||...|:|::.|:|.|.|.|.|
plant   133 MYLYFPCGIIRGVLSNLGIPCAVSADISSLPTCSFVIRV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 67/169 (40%)
AT3G05000NP_187151.1 TRAPPC6A_Trs33 6..172 CDD:271347 66/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1852
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 121 1.000 Inparanoid score I1972
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - oto4073
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.