DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and Trappc6a

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001102880.1 Gene:Trappc6a / 680465 RGDID:1591735 Length:159 Species:Rattus norvegicus


Alignment Length:159 Identity:70/159 - (44%)
Similarity:100/159 - (62%) Gaps:7/159 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVN--YCLD-----SNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELET 58
            |::.:||:.||.|:|.  :..|     ..|:..|:.||.:||..|..|.|||.||....::||:.
  Rat     1 MADAVLFEFLHTEMVAELWAPDPDPGSGGKKKSLSVLEGLGFRVGQALGERLPRETLAVREELDA 65

  Fly    59 MKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGA 123
            :||:|.|.|..:::|.:|.||||:.|.||:||.:|..|..:..|.:.||.||||:||||||:.||
  Rat    66 LKFLCKDLWAAMFQKHMDGLRTNHQGTYVLQDNSFPLLIPMGSGPQYLEEAPKFLAFTCGLLCGA 130

  Fly   124 LSNLGINSTVTAEVQSIPACKFHIEVNRN 152
            |..||..|.|||.|.|:|||||.:.:.::
  Rat   131 LHTLGFQSLVTASVASLPACKFQVVIQKS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 69/152 (45%)
Trappc6aNP_001102880.1 TRAPPC6A_Trs33 3..157 CDD:271347 69/153 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341815
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm45390
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.