DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and Trappc6a

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001318110.1 Gene:Trappc6a / 67091 MGIID:1914341 Length:183 Species:Mus musculus


Alignment Length:158 Identity:69/158 - (43%)
Similarity:96/158 - (60%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVN--YCLD-----SNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELET 58
            |::.:||:.||.|:|.  :..|     ..|...|:.||.:||..|..|.|||..|...|::||:.
Mouse     1 MADAVLFEFLHTEMVAELWAPDPDPGSGGKRRSLSVLEGLGFRVGQALGERLPLETPAFREELDA 65

  Fly    59 MKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGA 123
            :||:|.|.|..:::|.:|.||||:.|.||:||.:|..|..:..|.:.||.||||:||||||:.||
Mouse    66 LKFLCRDLWAAMFQKHMDGLRTNHQGTYVLQDNSFPLLVTMGSGPQYLEEAPKFLAFTCGLLCGA 130

  Fly   124 LSNLGINSTVTAEVQSIPACKFHIEVNR 151
            |..||..|.|||.|.|:|||:.....:|
Mouse   131 LHTLGFQSLVTASVASLPACRLEAGAHR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 67/152 (44%)
Trappc6aNP_001318110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm43319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.